BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20915 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 24 1.7 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 23 3.9 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 5.1 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 5.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 8.9 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.9 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 333 SLQPTGNTVEMECMITNT 280 S +P NTVE C++ NT Sbjct: 473 STRPKSNTVENACVLKNT 490 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 199 PKSHNGSVY 225 PK HNGS+Y Sbjct: 31 PKDHNGSIY 39 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -2 Query: 364 ILYCLVDKLVESSTNGKYSGNGMHDYKHPKQLCILHY 254 I+ L +K + ++ N KY+ N ++Y + L+Y Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNKYNYNNNNYNKKLYY 117 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 256 YG*GLICLAFDTQIHYVISANSTVVDNN 173 Y G+IC A YV++A ++D N Sbjct: 182 YEPGMICGATIISKRYVLTAAHCIIDEN 209 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = +1 Query: 187 LCYLPKSHNGSVYRMPSKSSLSHSEECTVA 276 +C L + +G+VY++ ++ +H+ T+A Sbjct: 38 VCALNELKSGAVYKVVDQTGPTHAPIFTIA 67 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 149 HSTFLLRIFFYLLCHY 102 H T LL++ YL C Y Sbjct: 40 HPTTLLKLKRYLFCEY 55 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 694 YTLLSNLCNFYLPC 653 + + S+L +FY+PC Sbjct: 343 FIIYSSLSSFYIPC 356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,532 Number of Sequences: 438 Number of extensions: 4433 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -