BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20914 (753 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_31675| Best HMM Match : zf-CCHC (HMM E-Value=0.012) 28 7.1 SB_58978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -3 Query: 706 VLTGLKKITNHYFQNKG 656 V+TGL+K TN+YFQ +G Sbjct: 1410 VITGLRKFTNYYFQVRG 1426 >SB_31675| Best HMM Match : zf-CCHC (HMM E-Value=0.012) Length = 550 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 112 GQLKKHTSTTPRGQSWKALGFIGEMLLRVHR 204 G L+K T S++ LGF+G + + VHR Sbjct: 333 GNLRKEDILTQYADSFEGLGFLGPVQMPVHR 363 >SB_58978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 357 IANVHNQA*LVTLKRTVSFYVFNDNTKEFI*RSKSSPS 470 +AN H QA + + TVS + NDN K+ + K P+ Sbjct: 88 VANNHEQAVVAHQENTVSVFEVNDNDKDAVTFRKIIPN 125 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,659,492 Number of Sequences: 59808 Number of extensions: 426221 Number of successful extensions: 753 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -