BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20913 (701 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 26 6.0 SPBC29A3.09c |||AAA family ATPase Gcn20 |Schizosaccharomyces pom... 25 7.9 SPAC13G6.10c |||O-glucosyl hydrolase |Schizosaccharomyces pombe|... 23 9.9 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 430 RWSSGALAECEQQIRQFIIQNVFREHPHSFLI 335 R ++ L+EC +R+ +QN F H L+ Sbjct: 849 RVANSKLSECSDDVRRLTLQNSFDLREHQTLV 880 >SPBC29A3.09c |||AAA family ATPase Gcn20 |Schizosaccharomyces pombe|chr 2|||Manual Length = 736 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 403 CEQQIRQFIIQNVFREHPHSFLINKTYLLVKS 308 C+ Q+R++ Q +R+H SF+ Y KS Sbjct: 447 CKNQLREYEKQMEYRKHLQSFIDKFRYNAAKS 478 >SPAC13G6.10c |||O-glucosyl hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 530 Score = 22.6 bits (46), Expect(2) = 9.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 465 SDGLATVWRRSSDGLAARWPSVSSK 391 S GLA+V S DG + P+ S++ Sbjct: 64 STGLASVTESSDDGASTALPTTSTE 88 Score = 20.6 bits (41), Expect(2) = 9.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 522 SHRGLRRSGDGLVTV 478 +HR RR DG++TV Sbjct: 24 NHRHHRRDDDGVLTV 38 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,631,477 Number of Sequences: 5004 Number of extensions: 52164 Number of successful extensions: 128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -