BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20911 (659 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC105005-1|AAI05006.1| 773|Homo sapiens diacylglycerol kinase, ... 30 6.4 AC073258-1|AAS07533.1| 413|Homo sapiens unknown protein. 30 6.4 AB018261-1|BAA34438.1| 742|Homo sapiens KIAA0718 protein protein. 30 6.4 >BC105005-1|AAI05006.1| 773|Homo sapiens diacylglycerol kinase, beta 90kDa protein. Length = 773 Score = 30.3 bits (65), Expect = 6.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 357 SWRSTDILHKSWRTGTCSPFCDIRSREMKDYR 262 S R+TD++H W G C CD + +K Y+ Sbjct: 301 SKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQ 332 >AC073258-1|AAS07533.1| 413|Homo sapiens unknown protein. Length = 413 Score = 30.3 bits (65), Expect = 6.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 357 SWRSTDILHKSWRTGTCSPFCDIRSREMKDYR 262 S R+TD++H W G C CD + +K Y+ Sbjct: 235 SKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQ 266 >AB018261-1|BAA34438.1| 742|Homo sapiens KIAA0718 protein protein. Length = 742 Score = 30.3 bits (65), Expect = 6.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 357 SWRSTDILHKSWRTGTCSPFCDIRSREMKDYR 262 S R+TD++H W G C CD + +K Y+ Sbjct: 239 SKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQ 270 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,964,661 Number of Sequences: 237096 Number of extensions: 1518932 Number of successful extensions: 3419 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3419 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7422585720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -