BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20911 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 25 0.64 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 25 0.64 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 25 0.64 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 6.0 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 0.64 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 657 FSQRKYQYFLVITKSTSIYRIHYIGILFNDI 565 F K YF + T S RIH+ G + I Sbjct: 100 FVNEKQSYFHIATTSNEFIRIHHSGSITRSI 130 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 0.64 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 657 FSQRKYQYFLVITKSTSIYRIHYIGILFNDI 565 F K YF + T S RIH+ G + I Sbjct: 100 FVNEKQSYFHIATTSNEFIRIHHSGSITRSI 130 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 25.0 bits (52), Expect = 0.64 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 657 FSQRKYQYFLVITKSTSIYRIHYIGILFNDI 565 F K YF + T S RIH+ G + I Sbjct: 39 FVNEKQSYFHIATTSNEFIRIHHSGSITRSI 69 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/52 (21%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 258 CCDNPSFHGYGCRKTDCKFLYANSCEEYQLISNC-CCVDLQKNSVDTPVVAP 410 C P Y CR +L + + +Q+ +C CC + + + P Sbjct: 43 CVPKP-IPSYACRGRCSSYLQVSGSKIWQMERSCMCCQESGEREASVSLFCP 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,134 Number of Sequences: 438 Number of extensions: 3141 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -