BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20909 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.6 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.6 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 Query: 258 CQEVFKGAISIITGTEHLTYPIFEWIHFKFWIC 160 C VF I ++LTY W H W+C Sbjct: 503 CVGVFTFNIIKFVPVKYLTYEYPWWSHVLGWLC 535 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 Query: 258 CQEVFKGAISIITGTEHLTYPIFEWIHFKFWIC 160 C VF I ++LTY W H W+C Sbjct: 556 CVGVFTFNIIKFVPVKYLTYEYPWWSHVLGWLC 588 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 644 SIIFIADLLSYLFGSCCII 700 +II+ L+ L G+CC+I Sbjct: 61 AIIYSMLLIMSLVGNCCVI 79 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 138 ITYGQSAHISRT 173 +TYGQ+ HIS T Sbjct: 64 LTYGQTNHISLT 75 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 138 ITYGQSAHISRT 173 +TYGQ+ HIS T Sbjct: 102 LTYGQTNHISLT 113 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 644 SIIFIADLLSYLFGSCCII 700 +II+ L+ L G+CC+I Sbjct: 61 AIIYSMLLIMSLVGNCCVI 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,987 Number of Sequences: 438 Number of extensions: 3524 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -