BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20908 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 25 0.55 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 25 0.55 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 25 0.55 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 25 0.55 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 25 0.55 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 25 0.55 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 25 0.55 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 25 0.55 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 25 0.55 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 25 0.55 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 25 0.55 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 0.55 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 25 0.55 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 25 0.55 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 25 0.73 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.2 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 9.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.0 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 9.0 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 52 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 90 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 301 NEREYREYRETSRERSRDRRERGRSREHRIIPSHYIEQI 339 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 25.0 bits (52), Expect = 0.73 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+R + E+ + R R + H+II SH+ E + Sbjct: 300 NEREYREYRETSRERSRDRRGRGRSREHRIIPSHYIEQI 338 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYV 633 N+ S+ ++ + R R + H+II SH+ E + Sbjct: 285 NENSYRKYRETSKERSRDRRERGRSREHRIIPSHYIEQI 323 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 Query: 511 LHNKRSFNEWATVGIHKIRQRYMM 582 +H K F +W T I Q+Y + Sbjct: 1401 IHYKPEFGDWDTAQISSTVQKYTL 1424 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 65 FLFLINIFLSV 97 FLFLI IFLSV Sbjct: 30 FLFLILIFLSV 40 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.0 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYVCKYSKLFKKSLY 669 N+R + ++ + R R K KII S+ Y Y + K LY Sbjct: 274 NEREYRKYRETSKGRSRDRTERERSKETKIISSNNYNYKNYNNNYNSKKLY 324 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.0 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +1 Query: 517 NKRSFNEWATVGIHKIRQRYMMFIMKNHKIIISHFYEYVCKYSKLFKKSLY 669 N+R + ++ + R R K KII S+ Y Y + K LY Sbjct: 285 NEREYRKYRETSKGRSRDRTERERSKETKIISSNNYNYKNYNNNYNSKKLY 335 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 311 FKFKSVTDVNSS 346 F FK +TD NSS Sbjct: 319 FNFKFITDANSS 330 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,168 Number of Sequences: 438 Number of extensions: 3876 Number of successful extensions: 23 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -