BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20907 (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0493 + 18299885-18299892,18300201-18300837,18301254-183016... 28 5.9 >10_08_0493 + 18299885-18299892,18300201-18300837,18301254-18301676, 18301769-18302014,18302124-18302789,18303228-18303283, 18303367-18303460,18303559-18303738 Length = 769 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 90 REVSTTTTPIPFPPCRADDIDCL-RRGLRTFFNLMDSGHYGMTPVDPIY 233 R+ S++ P PF P +D L R + +S YG P DP Y Sbjct: 463 RDGSSSNNPTPFAPFDGPPVDILPNREFMLYGRSANSPPYGGPPNDPPY 511 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,598,245 Number of Sequences: 37544 Number of extensions: 367008 Number of successful extensions: 849 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -