BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20907 (560 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z12172-1|CAA78163.1| 383|Homo sapiens putative homeotic protein... 31 2.8 U15979-1|AAA75364.1| 382|Homo sapiens dlk protein. 31 2.8 DQ017081-1|AAY40461.1| 315|Homo sapiens secredeltin protein. 31 2.8 BC014015-1|AAH14015.1| 383|Homo sapiens delta-like 1 homolog (D... 31 2.8 BC013197-1|AAH13197.1| 383|Homo sapiens delta-like 1 homolog (D... 31 2.8 BC007741-1|AAH07741.1| 383|Homo sapiens delta-like 1 homolog (D... 31 2.8 >Z12172-1|CAA78163.1| 383|Homo sapiens putative homeotic protein protein. Length = 383 Score = 31.1 bits (67), Expect = 2.8 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 390 VTCKSLLKSTPFL-----IPFSWNLLSTSLVQLIPVTMTFLNKKDSCCSGTRWRHCLCK 229 V+ K L K TP L I F+ + TSLV L V + FLNK ++ S R+ H L K Sbjct: 287 VSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRK 345 >U15979-1|AAA75364.1| 382|Homo sapiens dlk protein. Length = 382 Score = 31.1 bits (67), Expect = 2.8 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 390 VTCKSLLKSTPFL-----IPFSWNLLSTSLVQLIPVTMTFLNKKDSCCSGTRWRHCLCK 229 V+ K L K TP L I F+ + TSLV L V + FLNK ++ S R+ H L K Sbjct: 287 VSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRK 345 >DQ017081-1|AAY40461.1| 315|Homo sapiens secredeltin protein. Length = 315 Score = 31.1 bits (67), Expect = 2.8 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 390 VTCKSLLKSTPFL-----IPFSWNLLSTSLVQLIPVTMTFLNKKDSCCSGTRWRHCLCK 229 V+ K L K TP L I F+ + TSLV L V + FLNK ++ S R+ H L K Sbjct: 219 VSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRK 277 >BC014015-1|AAH14015.1| 383|Homo sapiens delta-like 1 homolog (Drosophila) protein. Length = 383 Score = 31.1 bits (67), Expect = 2.8 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 390 VTCKSLLKSTPFL-----IPFSWNLLSTSLVQLIPVTMTFLNKKDSCCSGTRWRHCLCK 229 V+ K L K TP L I F+ + TSLV L V + FLNK ++ S R+ H L K Sbjct: 287 VSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRK 345 >BC013197-1|AAH13197.1| 383|Homo sapiens delta-like 1 homolog (Drosophila) protein. Length = 383 Score = 31.1 bits (67), Expect = 2.8 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 390 VTCKSLLKSTPFL-----IPFSWNLLSTSLVQLIPVTMTFLNKKDSCCSGTRWRHCLCK 229 V+ K L K TP L I F+ + TSLV L V + FLNK ++ S R+ H L K Sbjct: 287 VSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRK 345 >BC007741-1|AAH07741.1| 383|Homo sapiens delta-like 1 homolog (Drosophila) protein. Length = 383 Score = 31.1 bits (67), Expect = 2.8 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 390 VTCKSLLKSTPFL-----IPFSWNLLSTSLVQLIPVTMTFLNKKDSCCSGTRWRHCLCK 229 V+ K L K TP L I F+ + TSLV L V + FLNK ++ S R+ H L K Sbjct: 287 VSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRK 345 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,624,466 Number of Sequences: 237096 Number of extensions: 1981188 Number of successful extensions: 3218 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3218 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5646880600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -