BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20903 (641 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97593-1|AAB52875.1| 715|Caenorhabditis elegans Hypothetical pr... 29 2.8 AC006603-7|ABB51201.1| 576|Caenorhabditis elegans Hypothetical ... 29 2.8 Z70680-2|CAA94573.1| 424|Caenorhabditis elegans Hypothetical pr... 28 6.5 >U97593-1|AAB52875.1| 715|Caenorhabditis elegans Hypothetical protein C46G7.3 protein. Length = 715 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -1 Query: 248 GSRHI--VCFESLPCSICFGNHHLVG 177 G RH +C+ +L C+ C G HH G Sbjct: 655 GERHSSSMCYSTLKCTYCSGRHHPAG 680 >AC006603-7|ABB51201.1| 576|Caenorhabditis elegans Hypothetical protein B0524.7 protein. Length = 576 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 316 ITPRTVVSGTEKATASREDTRDAVEELLEEQHAVRL 423 +T R VVSGT +++ RE+ ++LLEE +R+ Sbjct: 303 LTMRLVVSGTNQSSIDRENLLRKTKKLLEELKNLRI 338 >Z70680-2|CAA94573.1| 424|Caenorhabditis elegans Hypothetical protein C25G4.4 protein. Length = 424 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 280 DIMATVTCQ-KVHITPRTVVSGTEKATASREDTRDAVEELLE 402 DI +T+ + V PRT S E +RE T + VEEL++ Sbjct: 363 DIQSTLAEEHSVKYQPRTSSSSQESLHTAREFTEEKVEELID 404 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,979,774 Number of Sequences: 27780 Number of extensions: 212556 Number of successful extensions: 595 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -