BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20903 (641 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20630.1 68416.m02610 ubiquitin-specific protease 14, putativ... 28 6.1 >At3g20630.1 68416.m02610 ubiquitin-specific protease 14, putative (UBP14) similar to ubiquitin-specific protease 14 GI:11993473 [Arabidopsis thaliana] Length = 797 Score = 27.9 bits (59), Expect = 6.1 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Frame = +3 Query: 51 VATVRETPRVDTDVSVAAAEAHRTVIAAEALSLI-VKAVTAIGADKVVITKTDRTGKAFK 227 V TV + VAA A + +I+ AL+L +K+ I +K D+T + Sbjct: 132 VDTVVNAVGAERKEQVAAWTAEKKLISEHALTLQQIKSGIVIPPSGWKCSKCDKTENLWL 191 Query: 228 TDNMTATKIACERTGGDGYYGNGDVSE 308 N+T I C R DG GN E Sbjct: 192 --NLTDGMILCGRKNWDGTGGNNHAVE 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,256,203 Number of Sequences: 28952 Number of extensions: 194861 Number of successful extensions: 539 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -