BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20899 (437 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 122 8e-29 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 122 8e-29 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 31 0.45 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 1.4 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 1.4 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 29 1.8 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 29 1.8 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 3.2 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 3.2 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 4.2 At1g76010.1 68414.m08825 expressed protein 27 4.2 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 27 4.2 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 27 4.2 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 5.5 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 27 7.3 At4g29230.1 68417.m04181 no apical meristem (NAM) family protein... 26 9.7 At4g01000.1 68417.m00135 ubiquitin family protein low similarity... 26 9.7 At1g28080.1 68414.m03437 expressed protein 26 9.7 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 122 bits (295), Expect = 8e-29 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRRVNLRQR 434 QTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWHRRVN+ + Sbjct: 67 QTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMK 126 Query: 435 R 437 R Sbjct: 127 R 127 Score = 66.1 bits (154), Expect = 1e-11 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +1 Query: 76 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 249 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 250 GHK 258 GH+ Sbjct: 65 GHQ 67 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 122 bits (295), Expect = 8e-29 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRRVNLRQR 434 QTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWHRRVN+ + Sbjct: 66 QTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMK 125 Query: 435 R 437 R Sbjct: 126 R 126 Score = 68.1 bits (159), Expect = 2e-12 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 2/66 (3%) Frame = +1 Query: 67 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 240 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 241 KEAGHK 258 K+AGH+ Sbjct: 61 KKAGHQ 66 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 30.7 bits (66), Expect = 0.45 Identities = 21/70 (30%), Positives = 35/70 (50%) Frame = +1 Query: 91 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHKPVLN 270 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ + V Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICIYALGRMRSVWG 408 Query: 271 HGVLDVLSPE 300 LD PE Sbjct: 409 EDALD-FKPE 417 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 381 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 262 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 381 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 262 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +3 Query: 216 LEAALLREQGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 386 + AL+R + G ++ +AE + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRRMG-AKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 387 TKPW 398 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 142 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHKPVLNHGVLDVLSPE 300 P+PF K+P +PD++ H + NSR +C+ K V ++ PE Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCLYSLGRMKSVWGEDAME-FKPE 434 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 142 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHKPVLNHGVLDVLSPE 300 P+PF K+P +PD++ H + NS+ +C+ K V L+ PE Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCLYSLGRMKSVWGEDALE-FKPE 907 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 3.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEF 298 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 3.2 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 145 GAWLHPAPSHSSLSTPTLKVGLPID--SFRYFSEAIPPKY 32 G W+H SH+ S+ L VG+ + Y+S + P +Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 4.2 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 286 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 27.5 bits (58), Expect = 4.2 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 240 QGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 368 QG + G GR R R RGGG R G G F N G Sbjct: 303 QGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +3 Query: 237 EQGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 371 E GGW + + G GR R R RG G + + GG Sbjct: 178 EDGGWEREQSYGRGRGRGRGRSSRGRGRGGYNGPPNEYDAPQDGG 222 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 240 QGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 374 +G S+ + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 240 QGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 374 +G S+ + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.1 bits (57), Expect = 5.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 276 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 371 G GR R +GGG + G G+ G+ CR G Sbjct: 88 GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 26.6 bits (56), Expect = 7.3 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 243 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFG 353 G S+ S G + IP + GGGTHRSG + G Sbjct: 103 GSSSRGGGGSSSRGGGLRPIP-IYGGGTHRSGHHSSG 138 >At4g29230.1 68417.m04181 no apical meristem (NAM) family protein similar to NAM family proteins GP|12751304|, GP|6223650|, GP|9758909 - Arabidopsis thaliana,PIR2:T04621 Length = 498 Score = 26.2 bits (55), Expect = 9.7 Identities = 17/59 (28%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = -3 Query: 348 RHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFVTSLLAHAVGL---PRV-LGHRNVNIID 184 RH + HH H H Q H F S H + P L H ++NI+D Sbjct: 346 RHQPSSSTSHHMAHDHHHHHHQQQQQRHHAFNISQPTHPISTIISPSTSLHHASINILD 404 >At4g01000.1 68417.m00135 ubiquitin family protein low similarity to SP|P13117 Ubiquitin. {Neurospora crassa}; contains Pfam profile PF00240: Ubiquitin family Length = 415 Score = 26.2 bits (55), Expect = 9.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 330 RSGQGAFGNMCRGGRMFAPTK 392 R G+G FG++ RGG M A K Sbjct: 79 RGGKGGFGSLLRGGGMKAGQK 99 >At1g28080.1 68414.m03437 expressed protein Length = 291 Score = 26.2 bits (55), Expect = 9.7 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +1 Query: 133 AAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHKPVLNHGVLD 285 ++KP + AP RP ++D V+ + NS C E G P VLD Sbjct: 179 SSKPWIPQYMAPFRPSSLSDRDVT-NNNSLSRSCCVDEGGAGPSSEFRVLD 228 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,256,921 Number of Sequences: 28952 Number of extensions: 192179 Number of successful extensions: 682 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 692941200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -