BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20898 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.49 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 4.6 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 4.6 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 4.6 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 4.6 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 4.6 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 4.6 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 4.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 4.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 4.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 4.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 4.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 4.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 4.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 4.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 4.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.6 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 6.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 8.0 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 8.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 8.0 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 8.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.49 Identities = 8/32 (25%), Positives = 21/32 (65%) Frame = +1 Query: 277 QLNVFEQLHLMFLVRSTARAMCDASVLLEKAN 372 QLN + LH ++ V + ++ CD+ ++++ ++ Sbjct: 1466 QLNHYPDLHNLYAVPTDKKSACDSKLIVDHSS 1497 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -3 Query: 358 GVRRRRTSPSPWTERGTSGAV 296 G+ R++P+PW+E + A+ Sbjct: 561 GIELSRSNPTPWSEDAMTEAL 581 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 119 VSLNQAKSVLEFMLWGPLDVVQ 184 V N K ++EF+ G +DV Q Sbjct: 81 VCFNDLKFIIEFVYRGEIDVSQ 102 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 118 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 149 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 366 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 397 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 351 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 382 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -2 Query: 182 GPRPTAPIT*IPKLTLPDSTIQHAPPVGPLLG 87 G R P+T P +P + PP P G Sbjct: 367 GSRHIGPLTPFPPRFIPPDMYRLRPPPNPRFG 398 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 257 PVRPWLAPSPASAVGTTPSRPPAHLGPRPTAPI 159 P P P P G PS+ P+ + P + I Sbjct: 39 PPNPSQGPPPGGPPGAPPSQNPSQMMISPASGI 71 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 436 TFRTPEVNPGGATNINVTINKR 371 TF T E N G +++NV NK+ Sbjct: 82 TFVTIERNNGVPSSLNVVTNKK 103 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 396 LVAPPGLTSGVRNVMFDCLLS*HH*NNSKYE 488 L+ P G G+R MF L S N YE Sbjct: 606 LILPRGKPEGMRYKMFFFLSSMDESNTKSYE 636 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 396 LVAPPGLTSGVRNVMFDCLLS*HH*NNSKYE 488 L+ P G G+R MF L S N YE Sbjct: 606 LILPRGKPEGMRYKMFFFLSSMDESNTKSYE 636 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 502 ETFAILFALNVRLIDIFFCYLTTT 573 E F+I+F ++ LI I F Y T Sbjct: 3 ENFSIMFIHSIFLILIIFIYSNET 26 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 502 ETFAILFALNVRLIDIFFCYLTTT 573 E F+I+F ++ LI I F Y T Sbjct: 3 ENFSIMFIHSIFLILIIFIYSNET 26 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,287 Number of Sequences: 438 Number of extensions: 4332 Number of successful extensions: 28 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -