BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20897 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 26 0.38 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 26 0.38 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 3.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 6.2 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 8.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 25.8 bits (54), Expect = 0.38 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 454 AVPYQSRLCDPPLN*HHAFSVQPRTPLAPHQVPP 353 A PY + PL H AF V+ P PH PP Sbjct: 716 ASPY---MLQSPLTPHEAFDVKLPPPPHPHHQPP 746 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 25.8 bits (54), Expect = 0.38 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 454 AVPYQSRLCDPPLN*HHAFSVQPRTPLAPHQVPP 353 A PY + PL H AF V+ P PH PP Sbjct: 608 ASPY---MLQSPLTPHEAFDVKLPPPPHPHHQPP 638 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 74 EFNEVFNDVRVLLNN 118 EFN VFND R + N Sbjct: 452 EFNTVFNDQRTVFAN 466 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 491 RTIGTVVAFGVVFDGRRACHRVTWNSTCSSSL 586 RT+G++ F +F ++ +R + +T SSSL Sbjct: 316 RTLGSLPPFKWLFKKKKRRNRESTTNTQSSSL 347 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +1 Query: 241 WRKVFDPRSKCSFRY 285 W +VFD + K ++Y Sbjct: 306 WTRVFDDQQKVPYKY 320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,487 Number of Sequences: 336 Number of extensions: 3926 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -