BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20891 (572 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 25 0.61 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 3.2 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 24.6 bits (51), Expect = 0.61 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 8/48 (16%) Frame = +1 Query: 379 ISIHGRESNNL--ARILQTYYET------SHHPSLIWACVPMLCSRTY 498 I ++ ++++NL +++L TY + SH P W C+ C R + Sbjct: 22 IYLYWQQTSNLTTSKLLYTYRQPYPRQKKSHPPQWTWQCINQRCERRH 69 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 409 LARILQTYYETSHHPSLIWACVPMLCSR 492 L ++ T YE +H +++W+C C R Sbjct: 241 LTYLIWTIYEM-YHLAILWSCTSTNCPR 267 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 413 PEYSKLIMKRATIRL*YGHVYLCYVVEHI 499 P YS+L+ I YGH L ++ ++ Sbjct: 216 PIYSQLVFMCKKINKLYGHQLLLTILTYL 244 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 545 GLIPSFLF-FIIFMHSLYVLLHSIGTHAHI 459 GL+ F F I+ + + +L H GT AHI Sbjct: 1327 GLVFVFFFALILVIQFVAMLFHRFGTIAHI 1356 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 545 GLIPSFLF-FIIFMHSLYVLLHSIGTHAHI 459 GL+ F F I+ + + +L H GT AHI Sbjct: 1327 GLVFVFFFALILVIQFVAMLFHRFGTIAHI 1356 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 545 GLIPSFLF-FIIFMHSLYVLLHSIGTHAHI 459 GL+ F F I+ + + +L H GT AHI Sbjct: 1327 GLVFVFFFALILVIQFVAMLFHRFGTIAHI 1356 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 545 GLIPSFLF-FIIFMHSLYVLLHSIGTHAHI 459 GL+ F F I+ + + +L H GT AHI Sbjct: 1327 GLVFVFFFALILVIQFVAMLFHRFGTIAHI 1356 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -2 Query: 82 YVFITTRYFLLC-HFFY 35 Y F+ +FLLC ++FY Sbjct: 134 YYFVVPLFFLLCIYYFY 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,576 Number of Sequences: 336 Number of extensions: 3325 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -