BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20889 (622 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 1.7 SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 27 2.9 SPBC646.17c |dic1|SPBC855.01c, SPBP35G2.01c, mug44|dynein interm... 25 8.8 SPBC13G1.08c |ash2||Ash2-trithorax family protein|Schizosaccharo... 25 8.8 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 25 8.8 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 27.5 bits (58), Expect = 1.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 468 LPIGLRFLRQSLHSGLCSVCFK 533 LP G ++ HSGLC CF+ Sbjct: 346 LPCGEHTCKKRCHSGLCGACFE 367 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 26.6 bits (56), Expect = 2.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 544 FNASLKQTEQSPLWRDCRRNRSPI 473 F+ SLKQ+E +DC R R PI Sbjct: 335 FSESLKQSEILETIKDCLRQRKPI 358 >SPBC646.17c |dic1|SPBC855.01c, SPBP35G2.01c, mug44|dynein intermediate chain Dic1|Schizosaccharomyces pombe|chr 2|||Manual Length = 544 Score = 25.0 bits (52), Expect = 8.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 94 QPHRRGVACL*AEGTAHLERHL 159 QP +R +AC G H+ +HL Sbjct: 517 QPEKRNLACGGLNGNVHIYKHL 538 >SPBC13G1.08c |ash2||Ash2-trithorax family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 652 Score = 25.0 bits (52), Expect = 8.8 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 260 FGQQFSLLVVYDRYFCVRTFEGHTVVEKESFEPNKCLSKCAVPSAHKQ 117 F Q +L +DR +R ++G E+ + P+K + + +PS H + Sbjct: 468 FAQHTTLPSCHDR-IPIR-YKGQLYFEQPDYVPSKMMDELMIPSKHNR 513 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 225 SLLLCQDL*RTHCC*KREFRTKQMSFQVRSPFS 127 SL+LC R C KRE R+K+ SP+S Sbjct: 479 SLILCT---RNGTCWKRELRSKKREKSSSSPYS 508 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,370,928 Number of Sequences: 5004 Number of extensions: 45168 Number of successful extensions: 107 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -