BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20882 (751 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92812-9|CAM84813.1| 338|Caenorhabditis elegans Hypothetical pr... 30 1.5 AL032625-5|CAH60795.1| 498|Caenorhabditis elegans Hypothetical ... 30 2.0 U53335-2|AAU87823.1| 190|Caenorhabditis elegans Hypothetical pr... 29 3.5 AL034393-1|CAA22308.1| 1634|Caenorhabditis elegans Hypothetical ... 29 3.5 >Z92812-9|CAM84813.1| 338|Caenorhabditis elegans Hypothetical protein T03E6.9 protein. Length = 338 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 638 YLAETGLDYVESLCTCGSRERKLHLCMPLRNILCK 742 ++ + GL Y+ +C+ G+ +H+ +R ILCK Sbjct: 280 HITDYGLPYLLMICSQGTINNMIHIVPGIRKILCK 314 >AL032625-5|CAH60795.1| 498|Caenorhabditis elegans Hypothetical protein Y37H9A.1b protein. Length = 498 Score = 29.9 bits (64), Expect = 2.0 Identities = 28/106 (26%), Positives = 41/106 (38%), Gaps = 2/106 (1%) Frame = -3 Query: 680 YINSLRNPIQFLQDSRSTVVYEEVLHVDFQLEPIRTYLKTASE--RFFEKAARHDNPLRY 507 Y+N + + D +++ E L DF+ E + K SE RF + + RY Sbjct: 287 YLNEKATAMNSVVDVLDAILHAEALFADFRAEQPSDWPKIESEHPRFEVLKRKIEEERRY 346 Query: 506 GATQSRCSPKHVLQDPPDPLSVLLGSPITGHRSRRIFSVGRDSDPV 369 TQ R P Q P + + S + IFS R D V Sbjct: 347 EETQRR-YPDRPRQPLPPKIQRVESSESLSLLANTIFSKYRSIDDV 391 >U53335-2|AAU87823.1| 190|Caenorhabditis elegans Hypothetical protein C55C3.7 protein. Length = 190 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 171 CPEYNTCDHWTVRLLQKSQTAQHIDC-RVGHGCP 73 CP+ WT LQ SQ A+ DC V GCP Sbjct: 74 CPQTALMSQWTGWQLQNSQWARTRDCLTVSIGCP 107 >AL034393-1|CAA22308.1| 1634|Caenorhabditis elegans Hypothetical protein Y18D10A.1 protein. Length = 1634 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = -3 Query: 566 KTASERFFEKAARHDNPLRYGATQSRCSPKHVLQDPPDPLSVLLGSPIT---GH-RSRRI 399 +T S E AA P G +SR + K + + +PLS +P+ G RSR Sbjct: 526 RTLSTMSMEPAAAAVTPAPRGRPRSRSAAK--VSENTEPLSEAPSAPVKRGRGRPRSRST 583 Query: 398 FSVGRDSDPVEDST 357 S+ DS+P ST Sbjct: 584 MSITEDSEPSTSST 597 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,942,061 Number of Sequences: 27780 Number of extensions: 384632 Number of successful extensions: 961 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -