BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20876 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.1 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 3.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 9.3 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -2 Query: 228 ETSAASFLVTSWL*AVAAWLTSTIANVRSPQPR 130 + +F+VTSWL + +++ I V +P+ R Sbjct: 653 QPGVTAFIVTSWLGYMNSFVNPVIYTVFNPEFR 685 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 137 WGERTFAIV-EVNQAATAYNQLVTKK-DAADVSVNWNVWTGARPTSPESCS 283 WG++TF I+ + N ++ N + K + + + WT A+ E+CS Sbjct: 70 WGDKTFVIIMKFNGVPSSLNVITNKTGNGGPLLAPYPDWTWAK---NENCS 117 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 202 HELVVSCGRLVDFDDRER 149 H LV + GRL+DF ++ R Sbjct: 325 HILVATPGRLLDFVEKGR 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,259 Number of Sequences: 438 Number of extensions: 4598 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -