BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20873 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 2.2 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 22 5.1 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.0 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = -2 Query: 158 FDSISFTSPITSKLGFSSFTFFTISECFLALDKTNVFLFLGLLEPKI 18 F SIS T + ++GF ++ S + + + +L + P+I Sbjct: 218 FSSISITFKLAREMGFFMMDYYIPSILIVVISWVSFWLHMDASPPRI 264 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 263 IIEQNSH*RCSAIIQCSKK 319 I E+N H + S ++QC K Sbjct: 107 ISEENPHLKASKLVQCVSK 125 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +1 Query: 607 FSNAFSFLNVK*FFVIVQEIQITKFRHYY 693 F+N ++N FF I + F +Y+ Sbjct: 3 FNNVIKYINFDRFFFIEGMTNVLDFDYYF 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,808 Number of Sequences: 438 Number of extensions: 3655 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -