BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20871 (822 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 3.7 AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 24 4.9 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 24 4.9 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 423 PITETVNKQNMTSPTTTPSICRQGFVKNEKVY 518 P T+ + + +PTT P++ ++ + KVY Sbjct: 313 PTTQNKPRPGIVAPTTIPTVPKKSLAEVGKVY 344 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 154 HLVHLFVSDCMKLTERIDKRKHRMPQL 74 H VHL + +C+K R+ K +H Q+ Sbjct: 103 HAVHLAIDECVK---RLRKTRHMFEQM 126 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 154 HLVHLFVSDCMKLTERIDKRKHRMPQL 74 H VHL + +C+K R+ K +H Q+ Sbjct: 205 HAVHLAIDECVK---RLRKTRHMFEQM 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,218 Number of Sequences: 2352 Number of extensions: 14561 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -