BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20860 (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.1 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 22 5.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.4 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 7.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +1 Query: 130 EYPKCFIVGADNVGSQQMQQIRISLRXSSXVLMGKNTMMRKA 255 EYPKC+ V + + +R S KN ++ A Sbjct: 2443 EYPKCWQVDCNKGPDSDKEAFAAFVRELSAAFKPKNLLLSAA 2484 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.8 bits (44), Expect = 5.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 224 SWEKTL*CAKXQRPPGQQSSPRETVATHQGQR 319 S EK C R Q SS + TH G+R Sbjct: 45 SGEKPFRCPVCDRRFSQSSSVTTHMRTHSGER 76 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 331 NTKPTLPLMCGNSFSRAGLL 272 N KP + +CG S++R L Sbjct: 246 NQKPNVCRICGKSYARPSTL 265 Score = 21.8 bits (44), Expect = 5.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 224 SWEKTL*CAKXQRPPGQQSSPRETVATHQGQR 319 S EK C R Q SS + TH G+R Sbjct: 301 SGEKPFRCPVCDRRFSQSSSVTTHMRTHSGER 332 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 97 NYFVKIIQLLDEYPKCF 147 N KI L+DE+ +CF Sbjct: 214 NLHNKICNLIDEFNECF 230 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 4 SRAFCLVLKFHRSPYATLSR 63 S FCLV HR Y LS+ Sbjct: 20 SEIFCLVNFNHRESYFRLSK 39 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,769 Number of Sequences: 336 Number of extensions: 3710 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -