BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20858 (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 25 0.43 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 0.99 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 0.99 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 3.0 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 4.0 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 5.3 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 5.3 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 7.0 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 21 9.2 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 21 9.2 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 25.4 bits (53), Expect = 0.43 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +2 Query: 215 SQRPFLCLCRFRIAYATGTDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQ 385 S RPF + + A G S + + F+ +RT LA + TN N +++ Sbjct: 67 SCRPFKAYIKDPLTLAQGLVSTEMLLKKDSSEAFNEFRTKILAQVHGTNNGTNKNMR 123 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 0.99 Identities = 8/29 (27%), Positives = 20/29 (68%) Frame = +1 Query: 34 NADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +A ++++LG++W +L +++ + E A R Sbjct: 506 SAAINQILGRRWHALGREEQAKYYELARR 534 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 0.99 Identities = 8/29 (27%), Positives = 20/29 (68%) Frame = +1 Query: 34 NADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +A ++++LG++W +L +++ + E A R Sbjct: 398 SAAINQILGRRWHALGREEQAKYYELARR 426 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 499 SFLSRSRQETHLGSVRELR 443 SFLS+ E GS+RE++ Sbjct: 402 SFLSKRNSEKKCGSLREIK 420 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.2 bits (45), Expect = 4.0 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = +1 Query: 343 LGLPNKPAVQRSRSNAGIVSGKVSGAASRRSTPAEAP----LPTPDAS 474 + LP K + + ++ I++ KVS + + TP+ P P+ DAS Sbjct: 69 VALPPKREIPSPKRSSPILAEKVSVSPTTPPTPSPPPEERLTPSKDAS 116 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 278 PDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHV 382 P+T H PGA + Y+ + Q N +++G V Sbjct: 406 PNTHMGHEPGAAY--YQNENM---LQKNAEYSGKV 435 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 278 PDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHV 382 P+T H PGA + Y+ + Q N +++G V Sbjct: 354 PNTHMGHEPGAAY--YQNENM---LQKNAEYSGKV 383 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 455 YRPQMRLLSRTRKKTSSTGEAKDFEPFV 538 Y + ++ +KT + G DFE FV Sbjct: 305 YTTREGMIVEMMRKTETPGMPNDFEEFV 332 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 537 SISDTYSPYKSYRPGPTRSPRGR 605 SI+D SP+ GP PR R Sbjct: 137 SITDWMSPFDRVVCGPNGCPRRR 159 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 537 SISDTYSPYKSYRPGPTRSPRGR 605 SI+D SP+ GP PR R Sbjct: 196 SITDWMSPFDRVVCGPNGCPRRR 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,844 Number of Sequences: 336 Number of extensions: 3126 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -