BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20858 (675 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 65 6e-11 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 59 4e-09 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 56 2e-08 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 50 2e-06 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 50 2e-06 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 46 4e-05 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 46 4e-05 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 45 5e-05 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 43 2e-04 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 37 0.013 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 35 0.069 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.091 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 31 0.85 SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 30 1.5 SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) 30 2.0 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 30 2.0 SB_51106| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 29 2.6 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 29 2.6 SB_58895| Best HMM Match : SRCR (HMM E-Value=0) 29 3.4 SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) 29 3.4 SB_19940| Best HMM Match : Drf_FH1 (HMM E-Value=0.97) 29 3.4 SB_6181| Best HMM Match : Biotin_lipoyl (HMM E-Value=4.2) 29 3.4 SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) 29 4.5 SB_54257| Best HMM Match : Cache (HMM E-Value=4.4e-09) 29 4.5 SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 29 4.5 SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 29 4.5 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 4.5 SB_29559| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 29 4.5 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 28 6.0 SB_56923| Best HMM Match : PT (HMM E-Value=0.95) 28 6.0 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56087| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 28 7.9 SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_11668| Best HMM Match : rve (HMM E-Value=6.2e-14) 28 7.9 SB_7049| Best HMM Match : TF_Otx (HMM E-Value=1.6) 28 7.9 SB_5544| Best HMM Match : APG9 (HMM E-Value=7e-09) 28 7.9 SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064) 28 7.9 SB_29293| Best HMM Match : Ant_C (HMM E-Value=2.2) 28 7.9 SB_23496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_17894| Best HMM Match : UPF0005 (HMM E-Value=0.00021) 28 7.9 SB_15059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 64.9 bits (151), Expect = 6e-11 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +K A+ENP LHNA++SK+LGK W LT +D+RPFVE+AER Sbjct: 110 RKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAER 149 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKARPNQ 203 LR+ HM EHPNY+Y P+RR + R Q Sbjct: 150 LRIRHMKEHPNYRYTPKRRGRQDRRNGQ 177 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 62.5 bits (145), Expect = 3e-10 Identities = 23/40 (57%), Positives = 36/40 (90%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +K+A+E+PD+HNA++SK LGK+W+ L+ ++RPFVEE+ER Sbjct: 61 RKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESER 100 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/30 (56%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +3 Query: 111 SGALRVIHMTEHPNYKYRPRRRKQ-NKARP 197 S LR+ HM +P+YKYRPR++KQ KA+P Sbjct: 98 SERLRIRHMQAYPDYKYRPRKKKQPAKAKP 127 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 62.5 bits (145), Expect = 3e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 ++LAD NP+LHNA+LSKMLG WR+L +RPFV+EAER Sbjct: 382 RRLADANPELHNAELSKMLGLTWRALNSTQKRPFVDEAER 421 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNK 188 LR+ HM ++PNYKYRPRRRK +K Sbjct: 422 LRLQHMQDYPNYKYRPRRRKHSK 444 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 58.8 bits (136), Expect = 4e-09 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +KLAD+ P LHNA+LSK LGK W+ L +++PF+EEAER Sbjct: 80 RKLADQYPHLHNAELSKTLGKLWKLLNDSEKKPFIEEAER 119 Score = 38.3 bits (85), Expect = 0.006 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQ 182 LR+ H EHP+YKY+PRR+KQ Sbjct: 120 LRIKHKREHPDYKYQPRRKKQ 140 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 56.4 bits (130), Expect = 2e-08 Identities = 20/40 (50%), Positives = 32/40 (80%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +K+A ENP +HN+++SK LG +W+ L D++PFVEEA++ Sbjct: 343 RKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKK 382 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQN 185 LR HM EHP+YKYRPRR+ ++ Sbjct: 383 LRAQHMKEHPDYKYRPRRKPKS 404 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 56.4 bits (130), Expect = 2e-08 Identities = 20/40 (50%), Positives = 32/40 (80%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +K+A ENP +HN+++SK LG +W+ L D++PFVEEA++ Sbjct: 26 RKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKK 65 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQN 185 LR HM EHP+YKYRPRR+ ++ Sbjct: 66 LRAQHMKEHPDYKYRPRRKPKS 87 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 55.6 bits (128), Expect = 3e-08 Identities = 22/42 (52%), Positives = 34/42 (80%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAERCE 126 +KLA++ P +HNA+LSKMLGK WR L+ +++P+V+EA R + Sbjct: 127 RKLAEQYPHVHNAELSKMLGKLWRMLSAAEKQPYVDEAARLD 168 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = +3 Query: 132 HMTEHPNYKYRPRRRKQNKARP-NQXXXXXXXXXXXXXXXXXRTRQAPTRRTLASPTTPE 308 H +HP+YKYRPRRR+++ R Q +T+ T + SP TP Sbjct: 171 HKEDHPDYKYRPRRRQKSLKRAYGQPPRVVTNWAIQHAQDHFKTQVNGTTAPITSPNTPT 230 Query: 309 P-DSHLTEPRLLPRTTKQTSSSTVTF 383 + + LP+T T++ T+T+ Sbjct: 231 VLTQQVNTAQALPQTV-NTAAGTLTY 255 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 54.4 bits (125), Expect = 8e-08 Identities = 18/40 (45%), Positives = 33/40 (82%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +K+A +NP +HN+++SK LG +W+ L+ Q++RP+++EA R Sbjct: 805 RKMAQDNPKMHNSEISKRLGSEWKLLSEQEKRPYIDEARR 844 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQ 182 LR +HM EHP+YKYRPRR+ + Sbjct: 845 LRAVHMKEHPDYKYRPRRKSK 865 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAE 117 ++LA ENP LHN+ +SKMLG +WR LT ++++ F EA+ Sbjct: 23 RQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAK 61 Score = 38.3 bits (85), Expect = 0.006 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKA 191 L +HM EHP+YKYRPRRR + ++ Sbjct: 63 LNELHMIEHPDYKYRPRRRVKKRS 86 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAE 117 ++LA ENP LHN+ +SKMLG +WR LT ++++ F EA+ Sbjct: 23 RQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAK 61 Score = 38.3 bits (85), Expect = 0.006 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKA 191 L +HM EHP+YKYRPRRR + ++ Sbjct: 63 LNELHMIEHPDYKYRPRRRVKKRS 86 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/40 (45%), Positives = 32/40 (80%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +++A+E P + N+++SK LG +W SLT +++P+VEEA+R Sbjct: 24 RRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAKR 63 Score = 32.3 bits (70), Expect = 0.37 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKAR 194 LR +H +HP+YKY+P+R+ + + Sbjct: 64 LRELHKKDHPDYKYQPKRKPKTSPK 88 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/40 (45%), Positives = 31/40 (77%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +KLA + P++ N ++SK+LG +W L+ +++RPFV EA+R Sbjct: 25 RKLALKYPNMLNCEISKLLGAEWSRLSEEEKRPFVTEAKR 64 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKAR 194 LR IH ++P+Y Y+PRRRK + Sbjct: 65 LRTIHNQKYPDYSYKPRRRKSKTVK 89 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 45.6 bits (103), Expect = 4e-05 Identities = 17/42 (40%), Positives = 28/42 (66%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAERCE 126 K A NP +HN++ SK LG +W+ LT +++ PF+ E +R + Sbjct: 25 KHYASINPGMHNSEFSKSLGPEWKMLTSEEKDPFIAEPKRLQ 66 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 45.2 bits (102), Expect = 5e-05 Identities = 16/38 (42%), Positives = 29/38 (76%) Frame = +1 Query: 7 LADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +A+ENP +HN D+S+ LG +W+ LT +++ + EEA++ Sbjct: 37 IANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKK 74 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/86 (23%), Positives = 32/86 (37%), Gaps = 1/86 (1%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKARPNQXXXXXXXXXXXXXXXXXRTRQAPTRRTLASPT 299 L+ H +P+YKY+PR+R + R + PT + Sbjct: 75 LKEEHKERYPHYKYQPRKRDKTNKRGKMFHGSPFHFGFFPPSAPFYEGRFPTYALPSESR 134 Query: 300 TPEPDSHLTEPRLLPRTTKQ-TSSST 374 P P P P T ++ T++ST Sbjct: 135 LPYPHLETPVPMAEPLTREEATATST 160 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 44.0 bits (99), Expect = 1e-04 Identities = 15/38 (39%), Positives = 29/38 (76%) Frame = +1 Query: 4 KLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAE 117 ++ ENP ++NA LSK+LG W+ L+ +++ P++E+A+ Sbjct: 25 QILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAK 62 Score = 33.1 bits (72), Expect = 0.21 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRKQNKAR 194 L +H +HP+YKY+P+RRK ++ Sbjct: 64 LTEMHKEKHPDYKYQPKRRKSKSSK 88 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +1 Query: 16 ENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 ENP + NA++SK+LG +WR + ++ P+ EEA R Sbjct: 31 ENPKMRNAEISKILGDEWRKMPESEKLPYTEEALR 65 Score = 32.3 bits (70), Expect = 0.37 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRR 176 LR H +HPNY+Y+PRR+ Sbjct: 66 LRRQHKVDHPNYRYKPRRK 84 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 39.5 bits (88), Expect = 0.002 Identities = 12/40 (30%), Positives = 31/40 (77%) Frame = +1 Query: 10 ADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAERCES 129 + E P +HN+++SK+LG +W+++ + ++P++E+A+ ++ Sbjct: 28 SQECPRMHNSEISKILGCEWKAMKDELKQPYIEKAKELQA 67 Score = 31.9 bits (69), Expect = 0.49 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 120 LRVIHMTEHPNYKYRPRRRK 179 L+ H E+P YKY+PRRRK Sbjct: 65 LQAQHSRENPGYKYKPRRRK 84 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 39.5 bits (88), Expect = 0.002 Identities = 14/34 (41%), Positives = 27/34 (79%) Frame = +1 Query: 16 ENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAE 117 ++P L +++KMLG++W SL P++++ F++EAE Sbjct: 218 QHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAE 251 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 37.1 bits (82), Expect = 0.013 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +K+ ENPDL +++++LG W L ++ F+EEAE+ Sbjct: 193 EKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEK 232 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 36.7 bits (81), Expect = 0.017 Identities = 15/46 (32%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER-CESYI 135 +K+ E+P+L +++K+LG +W ++ D++ ++++AER E YI Sbjct: 160 EKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERYI 205 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 34.7 bits (76), Expect = 0.069 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 7 LADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +A P +NA++S LG+ W L+ + ++P+ +EA R Sbjct: 119 IAKRYPQANNAEISIRLGEIWNDLSSEQQKPYFDEATR 156 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 34.7 bits (76), Expect = 0.069 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 4 KLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAE 117 KLA + P+L + +L+ L KKWR ++ + ++ + E+ E Sbjct: 169 KLAKKYPNLKSTELAAKLSKKWRKMSEERKKAYTEQYE 206 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEE 111 K L NPD+ L K L +KW+ + + ++ ++++ Sbjct: 243 KDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKK 279 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 34.3 bits (75), Expect = 0.091 Identities = 34/148 (22%), Positives = 65/148 (43%), Gaps = 3/148 (2%) Frame = +2 Query: 98 RSSRKRSA--ASHTYDRAS*LQVQT*TAKAKQGQTQPTCHASQRPFLCLCRFRIAYATGT 271 RS +R++ +S + DR S ++++ A+++ + S+ L + ++ T Sbjct: 660 RSPPRRTSRWSSQSPDRRSPARIKSSPARSRSRSQSASPRHSKSKSPALSKVQVKTEKKT 719 Query: 272 DSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQPKL 451 SP G+ P S S+Y+ + V+ P SP+ SPE + E+ + Sbjct: 720 PSPPP-IKKTIGSASPP--PSHHRSEYKKRDVQDSPVRQPSLSPSPSPERKKEDPKEKSP 776 Query: 452 PYRPQMRLLSRT-RKKTSSTGEAKDFEP 532 P ++ +R+ RK SS E+ P Sbjct: 777 PLPKSKKMANRSYRKHNSSESESDSDSP 804 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 32.3 bits (70), Expect = 0.37 Identities = 24/92 (26%), Positives = 36/92 (39%), Gaps = 2/92 (2%) Frame = +2 Query: 269 TDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSP-EPQAEEVLQP 445 TD P + S G SPL D + TP S +++P PQ + + P Sbjct: 2592 TDRPRSAESRPSSYGVRGVTLSPLPLDQEPRPSDKQQAYTPPSESSKAPRSPQIRDAITP 2651 Query: 446 KLPYRPQMRL-LSRTRKKTSSTGEAKDFEPFV 538 + P R S +TS A++ +P V Sbjct: 2652 REPVSASDRTSTSEPSGRTSVGAPARERDPSV 2683 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 31.1 bits (67), Expect = 0.85 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEA 114 +KL E AD SK+ +KW++++ +++ FV++A Sbjct: 28 EKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKA 65 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 16 ENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAER 120 +NP+ LSK+LG+ W +T D+ + + A++ Sbjct: 123 DNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKK 157 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 31.1 bits (67), Expect = 0.85 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +2 Query: 299 NPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQP 445 +PG SP R P T Q + Q+P SP +P PQA QP Sbjct: 436 SPGHANSP-RPIPQFPSNPTGMQTSSMPQSPVRSPMNAPSPQAARTPQP 483 >SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/87 (24%), Positives = 41/87 (47%) Frame = +2 Query: 326 RTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQPKLPYRPQMRLLSRTRKKTSS 505 R + L +D NQ+ ++ T + +R+ P + + R Q R + T TSS Sbjct: 723 RMTTLIADESRNQRRYIYMTTRTAGKSRNRRPYIPMATRTAVESRNQRRCIHMT---TSS 779 Query: 506 TGEAKDFEPFVDIRHVFSVQIIQARSY 586 TG++++ P++ + +V+ R Y Sbjct: 780 TGKSRNRRPYIPMATRTAVESRNQRRY 806 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/76 (23%), Positives = 36/76 (47%) Frame = +2 Query: 359 NQQFNGHVQTPESSPARSPEPQAEEVLQPKLPYRPQMRLLSRTRKKTSSTGEAKDFEPFV 538 NQ+ H+ T + +R+ P + + R Q R + T TS+TG++++ P++ Sbjct: 768 NQRRCIHMTTSSTGKSRNRRPYIPMATRTAVESRNQRRYIHMT---TSTTGKSRNRRPYI 824 Query: 539 DIRHVFSVQIIQARSY 586 + +V+ R Y Sbjct: 825 PLATRTAVESRNQRRY 840 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +1 Query: 4 KLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEAE 117 ++ +ENPD+ + D+ K+ K W+ L +++ + E+A+ Sbjct: 346 QIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVWNEKAK 383 >SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) Length = 624 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/60 (28%), Positives = 24/60 (40%) Frame = +2 Query: 266 GTDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQP 445 GT S DTR H P P A + +NQ ++ P+ S + P A +P Sbjct: 381 GTASADTRCQHEVAVADPPVVCPPKACHFFSNQVVAPEMEGPQRSTSAQPAGTANGSAEP 440 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 4 KLADENPDLHNADLSKMLGKKWRSLTPQDRRPFVEEA 114 ++ ++NPD D+ K++G+ WR L +++ EA Sbjct: 45 QVKNQNPDFKLWDIGKIIGQMWRDLDDAEKQQEYNEA 81 >SB_51106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 568 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +2 Query: 266 GTDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSP 415 GT S DTR H P P A + +NQ ++ P+ S + P Sbjct: 236 GTASTDTRCQHEVAVADPPVVCPPKACHFFSNQVVASQMEGPQGSTSAQP 285 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 29.5 bits (63), Expect = 2.6 Identities = 8/26 (30%), Positives = 20/26 (76%) Frame = +1 Query: 40 DLSKMLGKKWRSLTPQDRRPFVEEAE 117 +++K+ G++W+ L + ++P+V +AE Sbjct: 530 EVAKLAGEEWKKLNDEQKKPYVAKAE 555 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/31 (29%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 43 LSKMLGKKWRSLTPQDRRPF-VEEAERCESY 132 + + G++WR ++ +D++P+ ++EAE Y Sbjct: 606 IPSLAGERWREMSDEDKKPYTIQEAEERNKY 636 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +1 Query: 1 KKLADENPDLHNADLSKMLGKKWRSLTPQDR 93 +++ D+NP + ++SK+ G+ W++LT + + Sbjct: 558 QEIKDKNPGISVTEVSKVAGEMWKNLTDKSK 588 >SB_58895| Best HMM Match : SRCR (HMM E-Value=0) Length = 1838 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 279 RTLASPTTPEPDSHLTEPRLLPRTTKQTSSST 374 R +SPTT + S T + +PR T+ T+S T Sbjct: 1065 RVTSSPTTVKATSRSTRTKFVPRITRVTASPT 1096 >SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) Length = 1081 Score = 29.1 bits (62), Expect = 3.4 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 14/99 (14%) Frame = +2 Query: 266 GTDSPDTRFSHNPGAGFSPY-----RTSPLASDYQTNQQFNGHVQTPESSPA----RSPE 418 GT S DTRF H SP + A QTNQ ++ P+ S + P+ Sbjct: 582 GTASADTRFQHELAVADSPVVCPQKHSGESAIPEQTNQVVASQMEEPQGSTSAQHLAEPD 641 Query: 419 PQAEE--VLQP-KLP--YRPQMRLLSRTRKKTSSTGEAK 520 QA E +P + P +R + R + R ++ GE+K Sbjct: 642 KQAAEQAAHEPARTPRRWRRESRAPNHPRPDLNTLGESK 680 >SB_19940| Best HMM Match : Drf_FH1 (HMM E-Value=0.97) Length = 494 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/76 (27%), Positives = 30/76 (39%) Frame = +2 Query: 266 GTDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQP 445 GT S T S +PG +P T A+ +NQ +Q P S+ +P P Sbjct: 324 GTASTVTMVSPSPGPHVTPVTTPSAAAPVSSNQPVVKIIQVPGSAGLSISKPVVVMTAGP 383 Query: 446 KLPYRPQMRLLSRTRK 493 P P + + T K Sbjct: 384 SKPSVPGVLSTNVTSK 399 >SB_6181| Best HMM Match : Biotin_lipoyl (HMM E-Value=4.2) Length = 86 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/76 (27%), Positives = 30/76 (39%) Frame = +2 Query: 266 GTDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQP 445 GT S T S +PG +P T A+ +NQ +Q P S+ +P P Sbjct: 2 GTASTVTMVSPSPGPHVTPVTTPSAAAPVSSNQPVVKIIQVPGSAGLSISKPVVVMTAGP 61 Query: 446 KLPYRPQMRLLSRTRK 493 P P + + T K Sbjct: 62 SKPSVPGVLSTNVTSK 77 >SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) Length = 649 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 380 VQTPESSPARSPEPQAEEVLQPKLPYRPQMRLLSRTRKKTSSTGE 514 +Q S + SP P ++ +P+ P + ++T+ KTSS+GE Sbjct: 509 IQKMTSIKSYSPAPYKQQESKPQRPSPSPTSIDAKTKVKTSSSGE 553 >SB_54257| Best HMM Match : Cache (HMM E-Value=4.4e-09) Length = 820 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 279 RTLASPTTPEPDSHLTEPRLLPRT 350 RTL P P P HLT P P T Sbjct: 475 RTLLHPNAPAPTDHLTAPTFQPLT 498 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 377 HVQTPESSP--ARSPEPQAEEVLQPKLPYRPQMRLLSRTRKKTSSTGEAKDFEP 532 H TP SSP A +P P+ L R Q L RT S+TG+++ P Sbjct: 39 HSPTPRSSPPKAATPSPKITRSWSSPLFNRRQAHALPRT--SVSNTGQSRQLPP 90 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 446 KLPYRPQMRLLSRTRKKTSST-GEAKDFEPFVDIRHVFS 559 K+PY ++R S + K +SST KD+ DI HV + Sbjct: 976 KIPYNNRVRSQSLSEKSSSSTVAMGKDYFEQADINHVIA 1014 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/89 (23%), Positives = 35/89 (39%), Gaps = 2/89 (2%) Frame = +2 Query: 263 TGTDSPDTRFSHNPGAGFSPYRTSPLASDYQTNQQFNGHVQTPESSPARSPEPQAEEVLQ 442 + TD+P H SP PL+ + ++ + H E S R ++ Sbjct: 509 SATDTPSDDKPHQDLVPTSPPPAKPLSDRVEKWERISNHGLDQERSSMRLSSELEDDAFL 568 Query: 443 PKLPYRPQMR--LLSRTRKKTSSTGEAKD 523 P L R Q +L+RT+++ S D Sbjct: 569 PSLSDRRQSAEDILARTKERRKSDNLTTD 597 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 400 SGKVSGAASRRSTPAEAP-LPTPDAS 474 SG S ++SRRS+P+ +P +PTP S Sbjct: 474 SGSSSSSSSRRSSPSGSPAIPTPSGS 499 >SB_29559| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 858 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 430 RSTPAEAPLPTPDASPVENEKE 495 RSTP+ PL TP A+P E ++E Sbjct: 9 RSTPSATPLATPMATPPEFDRE 30 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 373 RSRSNAGIVSGKVSGAASRRSTPAEAPLPTPDASPV 480 RS SN+ S K S S RS+P +P +P +SPV Sbjct: 334 RSPSNSPRPSPKNSPRTSPRSSPFASPTGSPTSSPV 369 >SB_56923| Best HMM Match : PT (HMM E-Value=0.95) Length = 441 Score = 28.3 bits (60), Expect = 6.0 Identities = 33/121 (27%), Positives = 44/121 (36%), Gaps = 6/121 (4%) Frame = +1 Query: 139 PSILTTSTDLDGESKTRPDPTNLPRQSAXXXXXXXXXDRVRDRHRLAGHSLLPQPRSRIL 318 P ++ S D + + + PD N Q A D LA L S Sbjct: 256 PELMLLSQDFNTDLNSFPDFVNGLGQLAMEDVPFEDLPTFEDAMALAQECLSTPTESTSS 315 Query: 319 TLQNLASCLGLPNK--PAVQ----RSRSNAGIVSGKVSGAASRRSTPAEAPLPTPDASPV 480 S + P + P VQ S+AG S S S + + A LPTPD SP+ Sbjct: 316 MTSPCGSQMSYPARSPPHVQCDPFSPTSSAGHPSPFPSPIGSHGPSISPAGLPTPDPSPL 375 Query: 481 E 483 E Sbjct: 376 E 376 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 355 NKPAVQRS-RSNAGIVSGKVSGAASRRSTPAEAPLPTPDASPVENEKE 495 NKP R+ R A I+S + R + E P+P +SPV NE++ Sbjct: 298 NKPTASRTARPPATILSKPIPARNRREDSDGE---PSPPSSPVSNEED 342 >SB_56087| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 403 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/102 (22%), Positives = 45/102 (44%), Gaps = 1/102 (0%) Frame = +2 Query: 362 QQFNGHVQTPESSPARSPEPQAEEVLQPKLPYRPQMRLLSRTRKKTSSTGEAKDFEPFVD 541 ++F+G + P + E +A P PY+P R+ + + + ++PF Sbjct: 41 ERFHGLILLRHHDPLKFTEEEAS----PSYPYKPLPRIPTSLSLVSLQASPSYPYKPFPR 96 Query: 542 IRHVFSVQIIQAR-SYSQPPWPQLVWPTAVRHVHTEDAHGEP 664 I S+ +QA SY P P++ PT++ + + + P Sbjct: 97 ITTSPSLVHLQASPSYPYKPLPRI--PTSLSLISLQASPSYP 136 >SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 413 PEPQAEEVLQPKLPYRPQMRLLSRTRKKTSSTGEAKD 523 P+ +L+P +P + + ++L R KK ++TG KD Sbjct: 34 PDDVKHRLLKPLVPAKTRGKILERFDKKLATTGCTKD 70 >SB_11668| Best HMM Match : rve (HMM E-Value=6.2e-14) Length = 597 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 323 YRTSPLASDYQTNQQFNG-HVQTPESSPARSPEPQAEEVLQPKLPYRPQMRLLSRTRKK 496 YR +PL+ Y ++ NG ++TP SP QA+ Q K + RL R ++ Sbjct: 399 YRRTPLSCGYSPSELLNGRQIRTPLDILVPSPAHQAQG-RQDKQAVKAAQRLAGRQDRR 456 >SB_7049| Best HMM Match : TF_Otx (HMM E-Value=1.6) Length = 235 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 316 LTLQNLASCLGLPNKPAVQRSRSNAGIVSGKVSGAASRRSTPAEAPLPTPDASP 477 LT+ +S +G ++PA + A S VSG ++R +PA P+ SP Sbjct: 13 LTVTMKSSFIGSTSEPAQEAQERKAS--SQPVSGVSTRTQSPASTGNPSEPQSP 64 >SB_5544| Best HMM Match : APG9 (HMM E-Value=7e-09) Length = 1288 Score = 27.9 bits (59), Expect = 7.9 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +1 Query: 274 LAGHSLLPQPRSRILTLQNLAS--CL-GLPNKPAVQRSRSNAGIVSGKVSGAASRRS 435 +AG L +P S LQ+ S CL GLP +PA+ S AG+ G V A +RRS Sbjct: 1112 IAGSVTLSEPCS----LQDFRSFDCLPGLPYEPAMATSDPTAGL-QGGVKAADTRRS 1163 >SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064) Length = 265 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = +1 Query: 259 RDRHRLAGHSLLPQPRSRILTLQNLASCLGLPNKPAVQRSRSNAGIVSGKVSGAASRR 432 + RHR + P+ RSR +N G P QRSRS + + SG+ S RR Sbjct: 192 KHRHRDSSSPSPPRHRSRS-PFRNGNKRKGFPTHRNKQRSRSVSPVQSGQASQVMKRR 248 >SB_29293| Best HMM Match : Ant_C (HMM E-Value=2.2) Length = 759 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 412 SGAASRRSTPAEAPLPTPDASPV 480 SGA R T EA P+PD SPV Sbjct: 578 SGAMYRTRTSPEAQRPSPDTSPV 600 >SB_23496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 Query: 413 PEPQAEEVLQPKLPYRPQMRLLSRTRKKTSSTGEAKDFEPFVDIRHVFS 559 P+ E + P+L YRPQ L TR ++ E D V RHV + Sbjct: 358 PKQSLESMRAPELAYRPQKDRLGTTRADSNRLLET-DTPVAVHCRHVMA 405 >SB_17894| Best HMM Match : UPF0005 (HMM E-Value=0.00021) Length = 344 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 244 AAEAEEGALTGVAGWLGLALFCFRRLGL 161 AAE AL G AG +GL C+ LGL Sbjct: 108 AAETTGRALVGGAGLVGLGALCYYGLGL 135 >SB_15059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 Query: 452 PYRPQMRLLSRTRKKTSSTGEAKDFEPFVDIRHVFSVQIIQARSYSQPP 598 P RPQ + KK S E F P DIR V ++ ++Y +PP Sbjct: 652 PLRPQSSPAKVSFKKAGSEVEETPFNPDSDIRERIHVTEVR-QTYPRPP 699 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,837,140 Number of Sequences: 59808 Number of extensions: 445921 Number of successful extensions: 1864 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 1607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1853 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -