BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20857 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.4 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 9.7 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/32 (34%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = -3 Query: 219 TDLCFIQNLDIFLLKK--NNQIPREKLRNSFE 130 +DLCF++++D +KK ++++ +K RN+ E Sbjct: 433 SDLCFVEDIDWSEIKKSSDHEVMVQKNRNATE 464 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 584 NSSTRVTTLAPLEKEDR 534 NSS R T++P EK+DR Sbjct: 983 NSSKRKKTVSPGEKKDR 999 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,605 Number of Sequences: 2352 Number of extensions: 13675 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -