BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20857 (731 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80845-2|AAK39179.2| 582|Caenorhabditis elegans Hypothetical pr... 30 1.9 U39471-1|AAA80132.4| 461|Caenorhabditis elegans Intestinal acid... 28 7.8 >U80845-2|AAK39179.2| 582|Caenorhabditis elegans Hypothetical protein C24A8.1 protein. Length = 582 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 392 HIKQFLCIIYCTQDIFVFTTNKNHFILYSMNYFV 291 H+ F+C YC D+ T++ H +L S++ V Sbjct: 56 HLPLFVCYFYCVLDVAASTSSIIHLVLISIDRLV 89 >U39471-1|AAA80132.4| 461|Caenorhabditis elegans Intestinal acid phosphatase protein4 protein. Length = 461 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 383 QFLCIIYCTQDIFVFTTNKNHFILYSMNYFVRCV 282 +FL Y Q+IFV +T+KN +L + + V C+ Sbjct: 93 KFLNTRYNQQEIFVRSTDKNRTLLSAFSNMVECM 126 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,931,883 Number of Sequences: 27780 Number of extensions: 321944 Number of successful extensions: 734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -