BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20857 (731 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25800.1 68418.m03062 exonuclease family protein contains exo... 28 7.3 At3g16580.1 68416.m02120 F-box family protein contains F-box dom... 28 7.3 At2g32620.1 68415.m03982 cellulose synthase family protein simil... 28 7.3 At1g78960.1 68414.m09206 lupeol synthase, putative / 2,3-oxidosq... 28 7.3 >At5g25800.1 68418.m03062 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 567 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = -2 Query: 535 GITVYIVQGYFI*YLD*GEEFVTLIYRKTSLNILDIMTDNLGTR*QYNILSNSYALF 365 GIT +++G D EEF+ L++++T L + D L + +N++ ++ L+ Sbjct: 264 GITAVMMEGVTTTLKDIQEEFLKLVFKETILVGHSLENDLLSLKISHNLVIDTAVLY 320 >At3g16580.1 68416.m02120 F-box family protein contains F-box domain Pfam:PF00646 Length = 382 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 111 CWTQQTLQRNFVVSLWEFDYFSLVKKC 191 C T L+ FV+ ++E D FSL+K+C Sbjct: 240 CGTSNFLKDAFVLRVFEGDRFSLLKQC 266 >At2g32620.1 68415.m03982 cellulose synthase family protein similar to Zea mays cellulose synthase-5 [gi:9622882], -4 [gi:9622880], -9 [gi:9622890] Length = 757 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 96 HNIQMCWTQQTLQRNFVVSLWEFDYFSLVKKCPNFE*NISLSVYKTI 236 H+IQ + Q+ R S W F F ++ K N+ L KT+ Sbjct: 593 HSIQSWYVSQSFWRIVATSSWLFSIFDIILKLLGLSKNVFLVSKKTM 639 >At1g78960.1 68414.m09206 lupeol synthase, putative / 2,3-oxidosqualene-triterpenoid cyclase, putative similar to lupeol synthase GI:1762150 from [Arabidopsis thaliana], 2,3-oxidosqualene-triterpenoid cyclase [Arabidopsis thaliana] GI:2738027 Length = 763 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -1 Query: 446 IEHTRYYDRQSRHAITVQHIKQFLCIIYCTQDIFVFTTNKNHF 318 +EH Y D S H IT+ +++ LC++ C ++ N +HF Sbjct: 354 MEHIHYEDENS-HYITIGCVEKVLCMLAC----WIENPNGDHF 391 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,408,745 Number of Sequences: 28952 Number of extensions: 268756 Number of successful extensions: 537 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -