BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20856 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22379| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11333| Best HMM Match : eIF-1a (HMM E-Value=4.1e-05) 74 1e-13 SB_3873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 29 4.7 SB_58556| Best HMM Match : 4F5 (HMM E-Value=5.7) 28 6.2 SB_39149| Best HMM Match : 4F5 (HMM E-Value=1.2) 28 6.2 SB_37404| Best HMM Match : 4F5 (HMM E-Value=5.7) 28 6.2 SB_13854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_13429| Best HMM Match : Vicilin_N (HMM E-Value=0.13) 28 6.2 >SB_22379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = +2 Query: 254 RKKVWINQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGGFPETVRINETVVYSVDG 433 RKKVWIN GDIIL+GLRDYQD KADVIL+Y PDEARNLK YG PE +IN+T ++ + Sbjct: 136 RKKVWINTGDIILLGLRDYQDTKADVILRYNPDEARNLKAYGELPENAKINDTNMFGPEE 195 Query: 434 LDE 442 DE Sbjct: 196 EDE 198 Score = 77.0 bits (181), Expect = 1e-14 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 135 LVFKEDGQEYAQVTKMLGNGRLEAMCFDGIKRLCHIRGKLEKK 263 L+ G+EYAQV KMLGNGRLEA+CFDG+KRLCHIRGKL KK Sbjct: 96 LINDRQGEEYAQVVKMLGNGRLEALCFDGMKRLCHIRGKLRKK 138 >SB_11333| Best HMM Match : eIF-1a (HMM E-Value=4.1e-05) Length = 72 Score = 73.7 bits (173), Expect = 1e-13 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 272 NQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGGFPE 391 N+GDIIL+GLRDYQD KADVIL+Y PDEARNLK YG PE Sbjct: 31 NKGDIILLGLRDYQDTKADVILRYNPDEARNLKAYGELPE 70 >SB_3873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 67 KTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVM 192 + KV++EK GEE K ++N+ ++ + ++ KS+R M Sbjct: 80 RKKVEQEKAKGEEIRKRAMENLEDMKKREESASKKSRRSGAM 121 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +1 Query: 58 TCRKTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVMAAWRPCALMASNACV 237 T R V E+ I RT++++ + + D+ P C V+ A PC L C Sbjct: 276 TARVYGVCEDLIRNRRRTRVQM--IFGGGAEEDRIVPLINGCEVLVATPPCFLRMLKRCY 333 Query: 238 TS 243 TS Sbjct: 334 TS 335 >SB_58556| Best HMM Match : 4F5 (HMM E-Value=5.7) Length = 215 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 67 KTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVM 192 K KV++EK GEE K ++ + + ++ + ++ KS+R M Sbjct: 97 KKKVEQEKAKGEEIRKRAMEKLGDTKKREESASKKSRRSGSM 138 >SB_39149| Best HMM Match : 4F5 (HMM E-Value=1.2) Length = 148 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 67 KTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVM 192 K KV++EK GEE K ++ + + ++ + ++ KS+R M Sbjct: 30 KKKVEQEKARGEEIRKRAMEKLGDTKKREESASKKSRRSGSM 71 >SB_37404| Best HMM Match : 4F5 (HMM E-Value=5.7) Length = 123 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 67 KTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVM 192 K KV++EK GEE K ++ + + ++ + ++ KS+R M Sbjct: 5 KKKVEQEKAKGEEIRKRAMEKLGDTKKREESASKKSRRSGSM 46 >SB_13854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 398 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 67 KTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVM 192 K KV++EK GEE K ++ + + ++ + ++ KS+R M Sbjct: 316 KKKVEQEKAKGEEIRKRAMEKLGDTKKREESASKKSRRSGSM 357 >SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 210 TWPPSGHYRASL*LGRTLVRLP*RPTH 130 TWP Y+A LG T + LP P+H Sbjct: 106 TWPSPADYQARPTLGNTHITLPQSPSH 132 >SB_13429| Best HMM Match : Vicilin_N (HMM E-Value=0.13) Length = 323 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 67 KTKVKEEKIGGEERTKMKLKNVSWSLRKTDKSTPKSQRCSVM 192 K KV++EK GEE K ++ + + ++ + ++ KS+R M Sbjct: 119 KKKVEQEKAKGEEIRKRAMEKLGDTKKREESASKKSRRSGSM 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,878,231 Number of Sequences: 59808 Number of extensions: 309757 Number of successful extensions: 673 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -