BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20855 (741 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.15c |||ubiquitin-protein ligase E3 RBBP6 family |Schizos... 29 0.92 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 29 0.92 SPAC13D6.02c |byr3||zinc finger protein Byr3|Schizosaccharomyces... 27 2.1 >SPBP8B7.15c |||ubiquitin-protein ligase E3 RBBP6 family |Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 28.7 bits (61), Expect = 0.92 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 195 PQGIRCQKCLEFGHWSYECKANA 263 P G C +C + GHW C NA Sbjct: 180 PPGYICYRCGQKGHWIQACPTNA 202 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 28.7 bits (61), Expect = 0.92 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = +1 Query: 628 LYNSYFQQTYTSKFSFSYFQQTYTSKFLFSYFLT 729 +Y YF +T+ F +F++T+T+++ + +T Sbjct: 3454 IYYDYFYKTFERYCDFWFFRRTFTTQYAYMIIMT 3487 >SPAC13D6.02c |byr3||zinc finger protein Byr3|Schizosaccharomyces pombe|chr 1|||Manual Length = 179 Score = 27.5 bits (58), Expect = 2.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 201 GIRCQKCLEFGHWSYECK 254 G++C C + GH S+EC+ Sbjct: 134 GVKCYSCGKIGHRSFECQ 151 Score = 27.1 bits (57), Expect = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 198 QGIRCQKCLEFGHWSYECKANAR 266 QG C KC GH + +C+ N + Sbjct: 81 QGAECYKCGRVGHIARDCRTNGQ 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,460,604 Number of Sequences: 5004 Number of extensions: 45686 Number of successful extensions: 136 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -