BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20854 (624 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23452-3|AAU87818.1| 1982|Caenorhabditis elegans Hypothetical pr... 29 2.0 U23452-2|AAU87819.1| 1987|Caenorhabditis elegans Hypothetical pr... 29 2.0 AL132859-6|CAB60493.3| 324|Caenorhabditis elegans Hypothetical ... 29 3.6 >U23452-3|AAU87818.1| 1982|Caenorhabditis elegans Hypothetical protein R07G3.3a protein. Length = 1982 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 239 ICSRPPRLFDPSAMAPEHKFMDISLKISDLFSEVTPINNLVVGSRDINRKLKTT 78 + PP DP A + +F D + KI+D +E+ +N V+ + + LK T Sbjct: 1346 LAEAPPGEGDPCAARLKLQFDDFTAKINDYKTEIENLNMKVLRMGILEKSLKNT 1399 >U23452-2|AAU87819.1| 1987|Caenorhabditis elegans Hypothetical protein R07G3.3b protein. Length = 1987 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 239 ICSRPPRLFDPSAMAPEHKFMDISLKISDLFSEVTPINNLVVGSRDINRKLKTT 78 + PP DP A + +F D + KI+D +E+ +N V+ + + LK T Sbjct: 1346 LAEAPPGEGDPCAARLKLQFDDFTAKINDYKTEIENLNMKVLRMGILEKSLKNT 1399 >AL132859-6|CAB60493.3| 324|Caenorhabditis elegans Hypothetical protein Y39C12A.7 protein. Length = 324 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 340 INFTFSDFYYNCK-RTAKTLSLRVKQGFLKNLNF-EFVHV 227 IN+ + +YYNC R T SL + +N+ F +F H+ Sbjct: 162 INYKLNRYYYNCSLRKLHTYSLTERYQISENIQFAKFFHI 201 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,952,343 Number of Sequences: 27780 Number of extensions: 218297 Number of successful extensions: 421 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 421 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -