BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20849 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 36 3e-04 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.4 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 35.9 bits (79), Expect = 3e-04 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 + DF++ + RQ+ G+E + + ++H DL N+L + +K+ DFGL Sbjct: 584 ENDFIIQPKHLLSIARQVALGMEHLAKTRVVHRDLAARNVLVC--ENHTVKVSDFGL 638 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -1 Query: 347 LCTSILFRICLVRFPRASHSSRSHPCFF*S*ISTRERGLDL 225 LCT I++ ++ + + +S P + ++ RE+ DL Sbjct: 550 LCTHIIYAFATLKDHKLAEASDKDPEMYDRVVALREKNPDL 590 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,501 Number of Sequences: 336 Number of extensions: 3130 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -