BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20849 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 98 6e-21 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 7e-17 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 70 2e-12 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 62 4e-10 SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) 61 1e-09 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 58 5e-09 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 56 4e-08 SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) 55 7e-08 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 55 7e-08 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 54 2e-07 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) 52 5e-07 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 52 5e-07 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 50 1e-06 SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 49 3e-06 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 49 3e-06 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 48 6e-06 SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 48 1e-05 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 47 1e-05 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) 47 2e-05 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 46 2e-05 SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) 46 2e-05 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 46 4e-05 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 45 7e-05 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 44 1e-04 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 44 1e-04 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 44 1e-04 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 44 1e-04 SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) 43 2e-04 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 43 2e-04 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 43 2e-04 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 43 3e-04 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_45| Best HMM Match : Pkinase (HMM E-Value=0) 42 4e-04 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 42 5e-04 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 42 7e-04 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 41 9e-04 SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 41 0.001 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) 41 0.001 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) 41 0.001 SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) 40 0.002 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.002 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.002 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 40 0.002 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 40 0.003 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 39 0.004 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.004 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 39 0.005 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) 39 0.005 SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) 38 0.006 SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 38 0.006 SB_3163| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 38 0.008 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.008 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.008 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 38 0.008 SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) 38 0.011 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 38 0.011 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 37 0.014 SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) 37 0.014 SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) 37 0.014 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.025 SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) 36 0.025 SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) 36 0.025 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.025 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 36 0.033 SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 36 0.033 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 36 0.033 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 36 0.033 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 36 0.044 SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) 35 0.058 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) 34 0.13 SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) 34 0.13 SB_37212| Best HMM Match : zf-C2H2 (HMM E-Value=2e-23) 34 0.13 SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) 33 0.18 SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.18 SB_56790| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 33 0.24 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 33 0.24 SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.24 SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) 33 0.24 SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.24 SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.31 SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_25981| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 32 0.41 SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 32 0.54 SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 32 0.54 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_6976| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 1.3 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 31 1.3 SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 1.3 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 30 1.7 SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_51639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_28514| Best HMM Match : MazG (HMM E-Value=6) 30 2.2 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_17544| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) 30 2.2 SB_51537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) 29 2.9 SB_46446| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.9 SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) 29 2.9 SB_25961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 29 2.9 SB_31358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) 29 3.8 SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) 29 5.1 SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) 29 5.1 SB_19037| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 5.1 SB_24054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) 28 6.7 SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) 28 6.7 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_42225| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 8.9 SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 98.3 bits (234), Expect = 6e-21 Identities = 44/74 (59%), Positives = 59/74 (79%) Frame = +1 Query: 502 VRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCL 681 V ++E I+GGELFERV+DED LTE+ +M Q+ +GIE VH++N+LHLDLKPENI+C+ Sbjct: 72 VMIMEFISGGELFERVVDED-CLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENIVCV 130 Query: 682 TKTGNRIKIIDFGL 723 +K IK+IDFGL Sbjct: 131 SKDSWDIKLIDFGL 144 Score = 29.1 bits (62), Expect = 3.8 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +2 Query: 308 IGRGKFGTVYLCREKSTGLELAA---KXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYD 478 I RGKFG V +K TG AA K + H RL+ L D Sbjct: 4 IVRGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLVGLLD 63 Query: 479 AYD 487 AYD Sbjct: 64 AYD 66 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 84.6 bits (200), Expect = 7e-17 Identities = 39/82 (47%), Positives = 63/82 (76%), Gaps = 2/82 (2%) Frame = +1 Query: 484 RLGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKP 663 R GE+ V ++E ++GGELFE++ ++D LTE+ +MRQI +G+E +HR++I+HLDLKP Sbjct: 119 RPGEMIV-IMEFVSGGELFEKICNDDN-LTEKEVIRYMRQILQGVEHMHRKSIVHLDLKP 176 Query: 664 ENILCLTKTGNR--IKIIDFGL 723 EN+LC+ + + +K+IDFG+ Sbjct: 177 ENVLCVIRPDGKEDLKLIDFGM 198 Score = 29.5 bits (63), Expect = 2.9 Identities = 21/75 (28%), Positives = 31/75 (41%) Frame = +2 Query: 263 KRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXX 442 ++ + E ++ + +GKFG V ++K TG LAAK Sbjct: 45 RKKKEKAETEKVEESVRKGKFGVVKKVKDKKTGEVLAAK-FIRTSSESKKEVMGEIAMMN 103 Query: 443 XLRHPRLIQLYDAYD 487 L RLI L DAY+ Sbjct: 104 HLHSKRLIYLADAYE 118 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 69.7 bits (163), Expect = 2e-12 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = +1 Query: 502 VRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPE 666 +R++ I+GGELFERV+DED LTE+ +M Q+ +GIE VH++N+LHLDLK + Sbjct: 133 IRMMMTISGGELFERVVDED-CLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKKQ 186 Score = 37.1 bits (82), Expect = 0.014 Identities = 21/74 (28%), Positives = 30/74 (40%) Frame = +2 Query: 266 RNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX 445 R + + Y + E+GRG+FG V C T + AK Sbjct: 445 RKEHIEDFYALEEEVGRGRFGVVRKCVHLKTAVHFVAK-SIKARPSQKEEFSREIDVMNE 503 Query: 446 LRHPRLIQLYDAYD 487 LRHP L ++ DA+D Sbjct: 504 LRHPNLSRIRDAFD 517 Score = 29.1 bits (62), Expect = 3.8 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +2 Query: 308 IGRGKFGTVYLCREKSTGLELAA---KXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYD 478 I RGKFG V +K TG AA K + H RL+ L D Sbjct: 4 IVRGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLVGLLD 63 Query: 479 AYD 487 AYD Sbjct: 64 AYD 66 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 64.1 bits (149), Expect = 1e-10 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Frame = +1 Query: 481 LRLGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLK 660 +R GE ++E + GG LF+ VI + + +E+ + RQ+ +E++H + I+H D+K Sbjct: 95 IREGETVCLIMEYVAGGSLFDEVIQQTYY-SEKQARLVTRQLLNALEYLHSRRIVHRDIK 153 Query: 661 PENILCLTKTGNR--IKIIDFGL 723 P+N+L L + GN IK+ DFGL Sbjct: 154 PDNLL-LKRIGNNVTIKLADFGL 175 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/80 (31%), Positives = 38/80 (47%) Frame = +2 Query: 275 DVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRH 454 +++ NY+ML IG G F V+ C E+ TGLE AAK LRH Sbjct: 26 NMSPNYDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRH 85 Query: 455 PRLIQLYDAYDWGKYMCVYL 514 ++ LY + G+ +C+ + Sbjct: 86 ENIVSLYSSIREGETVCLIM 105 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 62.1 bits (144), Expect = 4e-10 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 2/79 (2%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 EIY+ ++ELI GG+LF+ I TE + R +C+ + ++H++ I+H DLKPEN+ Sbjct: 517 EIYL-VMELIKGGDLFD-AISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENL 574 Query: 673 LCLTKTGNR--IKIIDFGL 723 L ++ + +K+ DFGL Sbjct: 575 LVHKRSDGQTHLKLADFGL 593 Score = 34.3 bits (75), Expect = 0.10 Identities = 24/81 (29%), Positives = 33/81 (40%), Gaps = 1/81 (1%) Frame = +2 Query: 248 SRFTIKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK-XXXXXXXXXXXXXXX 424 SR T K TDV Y ++G G F V C++K T E A K Sbjct: 436 SRVTDKEVTDV---YNFGQKLGDGNFAIVRQCKDKITQKEFAIKIIDKRKIRGKEKMIDD 492 Query: 425 XXXXXXXLRHPRLIQLYDAYD 487 RHP +++L++ YD Sbjct: 493 EIAIMRRCRHPNIVRLFEDYD 513 >SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) Length = 592 Score = 60.9 bits (141), Expect = 1e-09 Identities = 35/80 (43%), Positives = 48/80 (60%), Gaps = 6/80 (7%) Frame = +1 Query: 502 VRLLELITGGELFERVI--DEDFVLTERA---CTVFMRQICEGIEFVHRQNILHLDLKPE 666 + +LEL GG+L + D D + R+ +RQI EGI +H+QN +HLD+KP Sbjct: 222 ILVLELALGGDLHRHCVALDSDEPASSRSEKEVVYLLRQILEGIRHLHKQNYVHLDIKPN 281 Query: 667 NILCLT-KTGNRIKIIDFGL 723 NIL +T + IKIIDFGL Sbjct: 282 NILLMTDEIYPEIKIIDFGL 301 Score = 33.1 bits (72), Expect = 0.24 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 260 IKRNTDVNEN-YEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 + N++ +N Y++ +IGRG++ V K+TGLE AAK Sbjct: 134 VSPNSEPIDNFYDIHDQIGRGQYAVVRRVTHKTTGLEYAAK 174 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 E + + E + GG L + + F TE+ ++ + IC ++F+H+Q I H DLKPENI Sbjct: 166 ERFYLIFEKMRGGPLLKHIEKRKF-FTEKEASLVVNDICSALDFLHKQGIAHRDLKPENI 224 Query: 673 LCLTKTG-NRIKIIDFGL 723 LC + + +KI DF L Sbjct: 225 LCSHENKVSPVKICDFDL 242 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 58.8 bits (136), Expect = 4e-09 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCL-T 684 ++EL TGG L +R++ + F TER T + + EG+ ++H I H DLKPEN+L Sbjct: 143 VMELATGGVLLDRILSKGF-FTERDATRVIYMVLEGVRYLHSLGITHRDLKPENLLYYHP 201 Query: 685 KTGNRIKIIDFGL 723 ++I I DFGL Sbjct: 202 GNDSKIMITDFGL 214 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 58.4 bits (135), Expect = 5e-09 Identities = 27/76 (35%), Positives = 47/76 (61%), Gaps = 1/76 (1%) Frame = +1 Query: 499 YVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC 678 Y + +L+TGGELFE ++ ++ +E + ++Q+ ++ H I+H DLKPEN+L Sbjct: 89 YFLVFDLVTGGELFEDIVAREYY-SEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLL 147 Query: 679 LTK-TGNRIKIIDFGL 723 ++ G +K+ DFGL Sbjct: 148 ASRERGAMVKLADFGL 163 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 281 NENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 NE YE+ E+G+G F TV C + T +E A K Sbjct: 14 NEKYELKEELGKGAFSTVRKCCHRETKIEYAVK 46 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/79 (36%), Positives = 50/79 (63%), Gaps = 2/79 (2%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 EI++ ++EL+ GG+LFE ++ E TE + +R + ++++H +I+H D+KPEN+ Sbjct: 90 EIFL-VMELVKGGDLFEAIV-EATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENL 147 Query: 673 LCLTKTGNR--IKIIDFGL 723 L L R +K+ DFGL Sbjct: 148 LVLNLPNGRKSLKLADFGL 166 >SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 56.0 bits (129), Expect = 3e-08 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPEN 669 ++EL+ GGEL ER+ + + TE A +V MR+I +EF+H++ ++H DLKPE+ Sbjct: 346 VMELLAGGELLERIRKKK-MFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPES 398 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +1 Query: 520 ITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLT-KTGN 696 + GGELF+R++++ TE+ + ++QI E +++H I+H DLKPEN+L + + Sbjct: 91 VQGGELFDRIVEKGNY-TEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDS 149 Query: 697 RIKIIDFGL 723 +I I DFGL Sbjct: 150 KIMISDFGL 158 >SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 166 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 2/78 (2%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 ++Y+ ++EL+ GGEL +R++ L+ER M + I F+H + ++H DLKP NI Sbjct: 21 QVYI-VMELMRGGELLDRILKHK-CLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNI 78 Query: 673 LCLTKTG--NRIKIIDFG 720 + +G ++I+DFG Sbjct: 79 MYADDSGTPESLRIVDFG 96 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 2/78 (2%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 ++Y+ ++EL+ GGEL +R++ L+ER M + I F+H + ++H DLKP NI Sbjct: 288 QVYI-VMELMRGGELLDRILKHK-CLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNI 345 Query: 673 LCLTKTG--NRIKIIDFG 720 + +G ++I+DFG Sbjct: 346 MYADDSGTPESLRIVDFG 363 Score = 33.1 bits (72), Expect = 0.24 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 242 PVSRFTIKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 P +R R T + + YE+ EIG+G + + C K+ G E A K Sbjct: 222 PAARAFPIRTTCILDEYEIKEEIGKGAYSSCRRCVNKADGKEYAVK 267 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +1 Query: 496 IYVRLLELITGGELFERVID-EDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 +Y + E I GGEL + ++ L+E +RQI + +H Q I+H DLK ENI Sbjct: 88 VYCLVTEYIPGGELLGLIRSHQESRLSETQARPIVRQIVSALHHLHEQGIVHRDLKMENI 147 Query: 673 LCLTKTGNRIKIIDFGL 723 L L ++ IKI+DFGL Sbjct: 148 L-LDESKKTIKIVDFGL 163 >SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 53.6 bits (123), Expect = 2e-07 Identities = 20/36 (55%), Positives = 30/36 (83%) Frame = +1 Query: 616 IEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 ++++H NI+HLDLKPENI+C + N+IK++DFGL Sbjct: 461 LDYMHGNNIVHLDLKPENIMCESINSNQIKLVDFGL 496 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 53.6 bits (123), Expect = 2e-07 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 11/83 (13%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFV-----------LTERACTVFMRQICEGIEFVHRQNILHLD 654 ++E ++GGELFE ++ V L E+ F +QI G+++ HR ++H D Sbjct: 96 VMEYVSGGELFEYILKHGKVQCDKTSHFKVQLEEKDARRFFQQIISGVDYCHRHMVVHRD 155 Query: 655 LKPENILCLTKTGNRIKIIDFGL 723 LKPEN+L ++ IKI DFGL Sbjct: 156 LKPENLLLDSQL--NIKIADFGL 176 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 52.8 bits (121), Expect = 3e-07 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +1 Query: 532 ELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR-IKI 708 E+ RV + FV +E + +MRQ+ E + F H I+H DLKP N+L + + IK+ Sbjct: 9 EIVNRV-NAGFVYSEAVASHYMRQVLEAVSFCHENGIIHRDLKPHNVLLANRENSAPIKV 67 Query: 709 IDFGL 723 DFG+ Sbjct: 68 ADFGV 72 >SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) Length = 1663 Score = 52.0 bits (119), Expect = 5e-07 Identities = 23/54 (42%), Positives = 36/54 (66%) Frame = +1 Query: 499 YVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLK 660 Y+ + EL+ GG LF+ ++ D LTE+ +M Q+ EG++ +H NI+HLDLK Sbjct: 1162 YIIVTELLAGGRLFDYLVVMD-ALTEKVAIGYMHQVVEGVQHLHDLNIVHLDLK 1214 Score = 49.2 bits (112), Expect = 3e-06 Identities = 27/85 (31%), Positives = 38/85 (44%) Frame = +2 Query: 242 PVSRFTIKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXX 421 P + + D+++ Y + +E+GRG++ V C EKSTG E AAK Sbjct: 1077 PTHKSAVSWKNDIDQYYNIYAELGRGRYAVVKKCVEKSTGKEFAAK-MVKKRMLDPVDID 1135 Query: 422 XXXXXXXXLRHPRLIQLYDAYDWGK 496 L+HP L DAYD K Sbjct: 1136 REVTVLRMLKHPNLCIFLDAYDTPK 1160 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 52.0 bits (119), Expect = 5e-07 Identities = 27/78 (34%), Positives = 48/78 (61%) Frame = +1 Query: 490 GEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPEN 669 G++++ +LE +GG L + +++ + L E RQ+ EG++F+H ++H DLK N Sbjct: 301 GKLWM-MLEFCSGGALDDLMLELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGN 359 Query: 670 ILCLTKTGNRIKIIDFGL 723 +L L GN +K+ DFG+ Sbjct: 360 LL-LASDGN-VKMADFGV 375 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 260 IKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTG 361 I ++ D N N+E++ E+G G FG VY R K+ G Sbjct: 214 IIKDVDPNSNWELVGELGDGSFGKVYKDRYKTKG 247 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 52.0 bits (119), Expect = 5e-07 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +1 Query: 526 GGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR-I 702 GGELFE+ I + TE+ F ++I + + H N+ H DLKPEN+L + K+ N + Sbjct: 3 GGELFEQ-IRKKRRFTEKEAMKFTKEIAQALYHCHSFNVAHRDLKPENLLLVDKSENLVV 61 Query: 703 KIIDFG 720 K+ DFG Sbjct: 62 KLADFG 67 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 535 LFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR-IKII 711 L++ + + D +L E + QI +G+ F+H+ H D+KPEN+LC TG+ +KI Sbjct: 52 LYQMMKNRDKLLPESVIRNVIYQILQGLAFIHKHGYFHRDMKPENLLC---TGHELVKIA 108 Query: 712 DFGL 723 DFGL Sbjct: 109 DFGL 112 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/75 (37%), Positives = 43/75 (57%) Frame = +1 Query: 496 IYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 IY+ +L+L G+L E I + + E +F Q+ + +E++H + ++H DLK ENI Sbjct: 65 IYI-ILDLADNGDLLE-YIRSNGAIPENEARLFYHQLVDAVEYLHNKGVVHRDLKCENI- 121 Query: 676 CLTKTGNRIKIIDFG 720 L NRI I DFG Sbjct: 122 -LLNRDNRILISDFG 135 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/86 (33%), Positives = 44/86 (51%) Frame = +1 Query: 466 PTVRRLRLGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNIL 645 P V ++YV +L+L+ R+I D LT F+ QI G++++H +L Sbjct: 91 PPVNLDEFDDVYV-VLDLMESD--LHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVL 147 Query: 646 HLDLKPENILCLTKTGNRIKIIDFGL 723 H DLKP N+ L +KI DFG+ Sbjct: 148 HRDLKPSNL--LVNENAELKIGDFGM 171 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 L E M Q+ IEF+HR NI+H D+KPENIL ++++G +K+ DFG Sbjct: 42 LDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENIL-VSRSG-IVKLCDFG 90 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 48.4 bits (110), Expect = 6e-06 Identities = 30/71 (42%), Positives = 41/71 (57%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 + +L G+L E + LTE+A RQI G+ ++H Q+I+H DLK EN+L L K Sbjct: 128 ITDLAENGDLLEYIRTHG-ALTEKASRRLFRQITAGVHYIHSQDIVHRDLKCENLL-LDK 185 Query: 688 TGNRIKIIDFG 720 N I I DFG Sbjct: 186 DLN-IIISDFG 195 >SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 48.0 bits (109), Expect = 8e-06 Identities = 21/62 (33%), Positives = 37/62 (59%) Frame = +1 Query: 535 LFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIID 714 +++ +++ D L E F RQI I++ H+ +++H DLKPEN++ K + K+ D Sbjct: 1 MYDYIMNHDKGLPEEKARYFFRQIVLAIDYCHKLHVVHRDLKPENVI-FFKNQDMAKLTD 59 Query: 715 FG 720 FG Sbjct: 60 FG 61 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 QI G++F+H I+H D+KP+NIL +TK G ++KI DFGL Sbjct: 121 QILNGVDFLHTHRIVHRDIKPQNIL-VTKDG-QVKIADFGL 159 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/71 (33%), Positives = 42/71 (59%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E +GGE+F+ ++ + + A F RQI +++ H+++++H DLK EN+ L Sbjct: 158 VMEYASGGEVFDYLVAHGRMKEKEARAKF-RQIVSAVQYCHQKHVIHRDLKAENL--LLD 214 Query: 688 TGNRIKIIDFG 720 IKI DFG Sbjct: 215 ADMNIKIADFG 225 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/71 (25%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +2 Query: 290 YEMLSEIGRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXXXXXXXXXXXXXXLRHPRL 463 Y ++ IG+G F V L + TG E+A K L HP + Sbjct: 83 YRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQKLFREVRIMKFLDHPNI 142 Query: 464 IQLYDAYDWGK 496 ++LY+ + K Sbjct: 143 VKLYEVIETDK 153 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/78 (33%), Positives = 43/78 (55%) Frame = +1 Query: 487 LGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPE 666 L ++++ ++E GGELF ++ +E L ER Q+ +E +H +I+H DLK E Sbjct: 130 LSKLHI-VMEYACGGELFAKISNEG-KLPERIAKKLYGQVLSAVEHMHDNDIIHRDLKAE 187 Query: 667 NILCLTKTGNRIKIIDFG 720 N+ N +K+ DFG Sbjct: 188 NVFIAGP--NLVKVGDFG 203 >SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) Length = 335 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/42 (52%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGL 723 Q IE+VH +N +H D+KP+N L L K GN + IIDFGL Sbjct: 74 QTISRIEYVHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGL 115 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = +1 Query: 508 LLELITGGELFERVID-EDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLT 684 +LE GEL++ + E F E+ ++RQ+ + + + H + ++H D+KPEN+L L Sbjct: 105 ILEYAPRGELYKELTACEKF--DEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLL-LN 161 Query: 685 KTGNRIKIIDFG 720 G+ IKI DFG Sbjct: 162 YKGD-IKIADFG 172 >SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) Length = 280 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/44 (47%), Positives = 29/44 (65%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 F+ QI G++++H N+LH DLKP N+L T +KI DFGL Sbjct: 18 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCD--LKICDFGL 59 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/70 (32%), Positives = 39/70 (55%) Frame = +1 Query: 511 LELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKT 690 LE + GG + ++ + E ++RQI +G+ ++H ++H D+K NIL + T Sbjct: 694 LEWMAGGSI-SMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANIL-VDST 751 Query: 691 GNRIKIIDFG 720 G I+I DFG Sbjct: 752 GQDIRIADFG 761 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/71 (33%), Positives = 33/71 (46%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 L+E L + D LT T F I G+++ H + I HLDLKP N+ L Sbjct: 112 LMEYAGDRNLLNVIYDPSEALTNERRTKFAVDIARGLDYAHAKGIAHLDLKPGNV--LVG 169 Query: 688 TGNRIKIIDFG 720 + K+ DFG Sbjct: 170 ANDHCKLADFG 180 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/72 (33%), Positives = 42/72 (58%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 +++ + GG+L +I + E ++ ++ I+ VHR +H D+KP+NIL + K Sbjct: 732 VMDYVPGGDLMSLLIKFG-IFPEDYAKFYIAELVLAIDSVHRMGFVHRDIKPDNIL-IDK 789 Query: 688 TGNRIKIIDFGL 723 G+ IK+ DFGL Sbjct: 790 DGH-IKLTDFGL 800 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 4/75 (5%) Frame = +1 Query: 508 LLELITGGELFERVIDED--FVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCL 681 ++EL +GG LF + + L+E+ C +R + G++ +H I+H DLKP NI+ + Sbjct: 87 VMELCSGGSLFTMLEHPSNAYGLSEQDCIAVIRDVVAGMKHLHDNGIVHRDLKPGNIMRV 146 Query: 682 TK-TGNRI-KIIDFG 720 + G+ + K+ DFG Sbjct: 147 YRDDGSCVYKLTDFG 161 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/66 (37%), Positives = 38/66 (57%) Frame = +1 Query: 526 GGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIK 705 GG + + + D+ L E ++ QI +G+ F+H NI+H DLK NIL L K +K Sbjct: 13 GGSISQLLRDKG-PLVEETVRQYVWQILKGLSFLHGVNIIHRDLKGANIL-LDKEKRFLK 70 Query: 706 IIDFGL 723 + DFG+ Sbjct: 71 LTDFGI 76 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/74 (31%), Positives = 43/74 (58%) Frame = +1 Query: 499 YVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC 678 YV L++ + L ++ + L + +F+ Q+ G++++H N+LH D+KP N+L Sbjct: 98 YVYLVQEVMETNL-HTILQSNSSLGQDYTKLFLYQLLRGLKYIHSANVLHRDIKPSNLLV 156 Query: 679 LTKTGNRIKIIDFG 720 ++T +KI DFG Sbjct: 157 DSET-LMLKIGDFG 169 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 595 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 +R+I EG+ +H Q I+H DLKP NI G IK+ DFGL Sbjct: 1080 LREIVEGLAHIHSQGIIHRDLKPVNI--FLDAGGHIKLGDFGL 1120 >SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/76 (27%), Positives = 36/76 (47%) Frame = +2 Query: 260 IKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXX 439 + ++ + + Y + E+G+G+FG V C K TG + AAK Sbjct: 148 VLKSDAITKYYTIKDELGKGRFGVVCKCVNKKTGKQFAAKFIKCSKPQDREDVIHEMEIM 207 Query: 440 XXLRHPRLIQLYDAYD 487 +RH RL++L DA++ Sbjct: 208 NTIRHKRLLRLADAFE 223 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/67 (31%), Positives = 38/67 (56%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E GG+L R I L ER F+RQ+ ++++ ++ H+DLKP+N+L ++ Sbjct: 133 IMEYCGGGDL-SRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSR 191 Query: 688 TGNRIKI 708 +KI Sbjct: 192 HNPVLKI 198 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +1 Query: 496 IYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 IY+ + EL+ GG L + F L T +RQ+ ++++ N +H DL N Sbjct: 281 IYI-IQELMKGGCLLHYLRKSQFKLQSAEMTEMVRQVAAAMKYLESHNFIHRDLAARN-- 337 Query: 676 CLTKTGNRIKIIDFGL 723 CL +K+ DFGL Sbjct: 338 CLIGENRTVKVADFGL 353 >SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) Length = 355 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 571 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGL 723 T + + Q+ IE+VH +N +H D+KP+N L + K N++ +IDFGL Sbjct: 111 TMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGVGKHCNKLFLIDFGL 162 Score = 31.9 bits (69), Expect = 0.54 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 275 DVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 +V Y ++ +IG G FG +YL + G E+A K Sbjct: 14 EVGGKYRLVRKIGSGSFGDIYLAINTTNGEEVAVK 48 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/70 (30%), Positives = 37/70 (52%) Frame = +1 Query: 511 LELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKT 690 +E + GG + + + E + RQI +G+ ++H N++H D+K NI+ + Sbjct: 258 MEFVPGGSIAQ-ALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLM--P 314 Query: 691 GNRIKIIDFG 720 IK+IDFG Sbjct: 315 NGVIKLIDFG 324 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/76 (32%), Positives = 44/76 (57%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 E++V ++E + GG L + V + + AC R + + + F+H Q ++H D+K ++I Sbjct: 287 ELWV-VMEFLEGGTLTDIVTHTNLSEEQVACVC--RAVLKALTFLHSQGVIHRDIKSDSI 343 Query: 673 LCLTKTGNRIKIIDFG 720 L LT G +K+ DFG Sbjct: 344 L-LTSNGT-VKLSDFG 357 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/65 (32%), Positives = 36/65 (55%) Frame = +1 Query: 526 GGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIK 705 GG+L + D + E ++ +I I +H +H D+KP+N+L + +TG+ IK Sbjct: 163 GGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVKPDNVL-IDRTGH-IK 220 Query: 706 IIDFG 720 + DFG Sbjct: 221 LADFG 225 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +2 Query: 266 RNTDVNEN-YEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 R +++N + +++ IGRG FG V + ++K+TG A K Sbjct: 72 RRLSLSKNDFNVVNTIGRGHFGEVQVVKDKATGDVYAMK 110 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/51 (37%), Positives = 32/51 (62%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 +TE + +R I + ++H NI+HLD++P NI+ G+ +K+IDFG Sbjct: 141 VTEEDAALVIRGILNALCYLHELNIVHLDIRPANIMV---QGSDVKLIDFG 188 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 281 NENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 N Y E+GRGKF V C++ +T + AK Sbjct: 34 NAFYSFKEEVGRGKFAVVKGCQDVTTQKDFVAK 66 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/44 (43%), Positives = 29/44 (65%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 ++ Q+ G+ + H +LH DLKP+N+L + K G IK+ DFGL Sbjct: 73 YVYQLLSGVAYCHSHRVLHRDLKPQNLL-IDKNG-AIKLADFGL 114 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/72 (31%), Positives = 43/72 (59%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E + GG+L + ++ E+ + +I G++F+H I++ DLK +N+L L K Sbjct: 364 VMEYLNGGDLMFHIQNQG-KFDEKRSRFYAAEIVCGLQFLHELGIIYRDLKLDNVL-LDK 421 Query: 688 TGNRIKIIDFGL 723 G+ IK+ DFG+ Sbjct: 422 DGH-IKLADFGM 432 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKST 358 E++ +L +G+G FG V LC K T Sbjct: 285 EDFSLLKVLGKGSFGKVLLCELKET 309 >SB_45| Best HMM Match : Pkinase (HMM E-Value=0) Length = 851 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC-LT 684 +LEL+ G L E + + L A + + +G+ ++H ++ILH DLKP N+L Sbjct: 544 VLELMEGS-LNELLDLRESELGTDALLTLSKDLVDGLHYLHGKSILHRDLKPNNLLYHFQ 602 Query: 685 KTGNRIKIIDFGL 723 R+KI DFGL Sbjct: 603 DETPRLKIADFGL 615 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGL 723 Q+ IE+VH +N +H D+KP+N L + + N++ +IDFGL Sbjct: 116 QMIARIEYVHNKNFIHRDIKPDNFLMGIGRHCNKLYLIDFGL 157 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 257 TIKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 T K V Y ++ +IG G FG +YLC G E A K Sbjct: 3 TPKSEFIVQGKYRLVRKIGSGSFGDIYLCVHTENGEEKAVK 43 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/44 (47%), Positives = 28/44 (63%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 ++ QI I F H + ILH DLKP+N+L +K IK+ DFGL Sbjct: 214 YLYQITNAIYFCHARRILHRDLKPQNLLIDSK--GLIKLADFGL 255 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 41.5 bits (93), Expect = 7e-04 Identities = 24/76 (31%), Positives = 43/76 (56%) Frame = +1 Query: 493 EIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 E++V ++E + GG L + V + + E R+ + +EF+H ++H D+K +NI Sbjct: 291 ELWV-VMEYLAGGSLTDVVTET--CMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNI 347 Query: 673 LCLTKTGNRIKIIDFG 720 L L G ++K+ DFG Sbjct: 348 L-LGMDG-QVKLTDFG 361 >SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 3/44 (6%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNR---IKIIDFGL 723 Q+ IE+VH +N+++ D+KPEN L K+ + I IIDFGL Sbjct: 148 QLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGL 191 >SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +1 Query: 502 VRLLELITGGELFERVIDEDF-VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC 678 V ++ G + VID D L + F I + +E +H +NI HLDLKP NI Sbjct: 144 VLIIMEFAGSRNLQTVIDNDRETLDSKRRLNFACDITKALEAIHNKNIAHLDLKPSNI-- 201 Query: 679 LTKTGNRIKIIDFG 720 + + + K+ DFG Sbjct: 202 IVNSHDVCKLADFG 215 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +1 Query: 595 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 M I E ++++H N++H DLKPENIL L + N +KI DFG Sbjct: 601 MLSIFEAVDYMHYHNVVHRDLKPENIL-LDEEIN-VKISDFG 640 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 41.1 bits (92), Expect = 9e-04 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +1 Query: 499 YVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 Y + EL GG+L + + L E F+RQI ++++H+ I+H DLK EN+L Sbjct: 255 YYLVFELAGGGDLMDYICYRKR-LGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLL 312 >SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 1/77 (1%) Frame = +1 Query: 496 IYVRLLELITGGELFERVIDEDFVLTERACTVFMR-QICEGIEFVHRQNILHLDLKPENI 672 IY+ + EL+ G L E + ++ A + M QI EG+ F+ + LH DL NI Sbjct: 320 IYI-ITELMPKGSLLEHLRSDEGRALSVAIQIDMGGQIAEGMAFLEKYGYLHRDLAARNI 378 Query: 673 LCLTKTGNRIKIIDFGL 723 L N +K+ DFGL Sbjct: 379 --LVGENNTVKVADFGL 393 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +1 Query: 535 LFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKII- 711 L E V D F +E ++Q G+ +H NI+H D+KP N+L T + ++ Sbjct: 273 LQEYVEDPRFDRSELQPLTVLQQATSGLAHLHSLNIVHRDIKPHNVLISKATSGHVNVMI 332 Query: 712 -DFGL 723 DFGL Sbjct: 333 SDFGL 337 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/72 (33%), Positives = 40/72 (55%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++EL TG L + ++ +D L E F +I + + ++H I++ DLKP +L L Sbjct: 74 VVELCTGSTLAD-ILSQDTGLPEATVKHFGAEIAKALFYIHTLGIVYCDLKPSKVL-LDG 131 Query: 688 TGNRIKIIDFGL 723 GN +K+ DF L Sbjct: 132 PGN-VKLSDFAL 142 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKST 358 ENY + E+GRG+ VY R+K + Sbjct: 2 ENYVLYDEVGRGEHSIVYKGRKKGS 26 >SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) Length = 888 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/72 (33%), Positives = 40/72 (55%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++EL TG L + ++ +D L E F +I + + ++H I++ DLKP +L L Sbjct: 74 VVELCTGSTLAD-ILSQDTGLPEATVKHFGAEIAKALFYIHTLGIVYCDLKPSKVL-LDG 131 Query: 688 TGNRIKIIDFGL 723 GN +K+ DF L Sbjct: 132 PGN-VKLSDFAL 142 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKST 358 ENY + E+GRG+ VY R+K + Sbjct: 2 ENYVLYDEVGRGEHSIVYKGRKKGS 26 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/71 (36%), Positives = 39/71 (54%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 LLE GGELF + F +I ++++H +I++ DLKPENIL L + Sbjct: 117 LLEYACGGELFTYLRTAGR-FNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENIL-LDR 174 Query: 688 TGNRIKIIDFG 720 G+ +K+ DFG Sbjct: 175 DGH-VKLTDFG 184 >SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +1 Query: 592 FMRQICEGIEFVHRQN--ILHLDLKPENILCLTKTGNRIKIIDFGL 723 F QI G+ ++H + I H DLKP+NIL L K RIK+ DFGL Sbjct: 169 FSGQIASGLMYLHGLSPPISHRDLKPDNIL-LDKRSMRIKLADFGL 213 >SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) Length = 279 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +1 Query: 625 VHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 +H+ I+H DLKPENIL + + IK+IDFG Sbjct: 12 LHKNRIIHCDLKPENILLKQQGRSGIKVIDFG 43 >SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) Length = 424 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/40 (40%), Positives = 30/40 (75%) Frame = +1 Query: 604 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 + EG+E++HR+N++H D+K N++ LT + I++IDF + Sbjct: 135 VMEGVEYLHRKNVMHRDIKGANVM-LTNEAD-IRLIDFAI 172 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 266 RNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 R+ D +++++ IG G +G VY R TG AAK Sbjct: 49 RSLDPPVDWQLVESIGEGTYGEVYKVRNVKTGEIAAAK 86 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/71 (32%), Positives = 38/71 (53%) Frame = +1 Query: 511 LELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKT 690 +E GG L + + + + E+ +Q+ ++++H NILH DLK NI LTK Sbjct: 105 MEYADGGTLAQYLTKLEKDMEEKDILNMFQQMLSALKYIHNNNILHRDLKTANIF-LTK- 162 Query: 691 GNRIKIIDFGL 723 +K+ DFG+ Sbjct: 163 DTVVKLGDFGI 173 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/64 (35%), Positives = 39/64 (60%) Frame = +1 Query: 529 GELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI 708 GE+F+ + + + A F+ QI +++ H+++++H DLK EN+L L + N IKI Sbjct: 239 GEMFDYLAHHGRLPEKEARKKFV-QILSAVDYCHKRHVVHRDLKAENLL-LDQNMN-IKI 295 Query: 709 IDFG 720 DFG Sbjct: 296 ADFG 299 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/72 (26%), Positives = 44/72 (61%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E + GG + + + + E +R++ +G++++H + LH D+K N+L +++ Sbjct: 886 IMEYLGGGSALDLMKAGN--IEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVL-MSE 942 Query: 688 TGNRIKIIDFGL 723 TG+ +K+ DFG+ Sbjct: 943 TGD-VKLADFGV 953 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/72 (29%), Positives = 41/72 (56%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E ++GG+L + L E + +IC + F+H + +++ DLK +N+L L Sbjct: 102 VIEYVSGGDLMYHM-QRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVL-LDS 159 Query: 688 TGNRIKIIDFGL 723 G+ IK+ D+G+ Sbjct: 160 DGH-IKLTDYGM 170 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/71 (36%), Positives = 37/71 (52%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 +LEL G+L + ++ + L E ++I +G+ HR+ I H DLK ENIL K Sbjct: 145 VLELAQNGDLLQ-LLQKKKQLHENEARKIFKKIVKGVLHCHRKGIAHRDLKLENILLSRK 203 Query: 688 TGNRIKIIDFG 720 N I DFG Sbjct: 204 --NEPIISDFG 212 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/72 (30%), Positives = 41/72 (56%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E + GG+ + + + + A F + +E++H I+H D+KP+N+L +T Sbjct: 35 VMEYVEGGDCASLLKNIGALPADLARMYFAETVL-AVEYLHSYGIVHRDIKPDNLL-ITS 92 Query: 688 TGNRIKIIDFGL 723 G+ IK+ DFGL Sbjct: 93 LGH-IKLTDFGL 103 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/44 (36%), Positives = 34/44 (77%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 ++ Q+ + I++ H+ +++H D+KPEN+L ++KT + +K+ DFG+ Sbjct: 130 YIFQLIKAIKWCHQNDVIHRDIKPENLL-ISKT-DILKLCDFGI 171 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 LTE F+RQ+ +G+ + H++N LH D+K NIL Sbjct: 82 LTEDHIKSFIRQLLDGLNYCHKKNFLHRDIKCSNIL 117 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/92 (32%), Positives = 50/92 (54%) Frame = +1 Query: 448 PAPSTDPTVRRLRLGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFV 627 P+ T + +L G Y+ + E + GG+L + E F L RA ++ ++Q+ G+ V Sbjct: 67 PSIITIYDIDQLADGRHYLTM-EFVPGGDLAQHK-GEVFDLP-RALSI-VQQVASGLAVV 122 Query: 628 HRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 H + ++H D+KP NIL G + I DFG+ Sbjct: 123 HGKGLVHRDIKPANIL-FRSDGTAV-ITDFGV 152 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 F QI E +E +HR +H DL NIL + + N +KI DFGL Sbjct: 966 FCLQIAEAMEALHRDKCIHRDLAARNILVVKE--NLVKISDFGL 1007 >SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 700 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 547 VIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRI-KIIDFGL 723 V +ED VLT F Q+ +G+E++ ++ +H DL N+L N++ K+ DFGL Sbjct: 606 VKEEDDVLTSGDLMAFAWQVAQGMEYLSKRGFVHRDLAARNVLV---GDNKVAKVADFGL 662 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/76 (35%), Positives = 38/76 (50%) Frame = +1 Query: 496 IYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 IY+ LLEL L E + LTE FM+QI + ++H+ I+H DLK N+ Sbjct: 113 IYI-LLELCPRRSLME-LHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRDLKLGNL- 169 Query: 676 CLTKTGNRIKIIDFGL 723 +K+ DFGL Sbjct: 170 -FLNDDMEVKVGDFGL 184 >SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) Length = 184 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 526 GGELFERVID-EDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 G + +I+ E V+ E F +C +EF+H + I HLD+KP NI Sbjct: 125 GNKTLRTIINCEKEVIDESRRLKFACHLCSALEFIHEREIAHLDVKPANI 174 >SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) Length = 481 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCL--TKTGNRIKIIDFG 720 QI +GI ++H +LH DLKP NIL + R+KI D G Sbjct: 29 QILDGIHYLHSNWVLHRDLKPANILVMGDGPERGRVKIADMG 70 >SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 591 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 LT+ F RQI G+E++ ++ +H DL NIL N +KI DFGL Sbjct: 502 LTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILIC--EDNLVKISDFGL 551 >SB_3163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +2 Query: 278 VNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 V+ +++ EIG G+F V C EKS+GLE AAK Sbjct: 13 VHHKFDIGDEIGSGQFAVVKKCSEKSSGLEFAAK 46 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/70 (22%), Positives = 38/70 (54%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 ++E + GG+L ++ +D TE ++ + I+ +H+ +H D+KP+N+L ++ Sbjct: 126 VMEFLPGGDLMTLLMKKD-TFTEEETRFYIAEALLAIDSIHQLGFIHRDIKPDNLLLDSR 184 Query: 688 TGNRIKIIDF 717 + + D+ Sbjct: 185 AYSTVGTPDY 194 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +2 Query: 260 IKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 +KR+ E+++ L IGRG FG V L +++ TG A K Sbjct: 40 LKRSRIGKEDFDSLKVIGRGAFGEVRLVQKQDTGHVYAMK 79 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 37.9 bits (84), Expect = 0.008 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +1 Query: 571 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 +E M Q+ EG +++H I+H DLK N+L LT G +KI DFGL Sbjct: 133 SEAQIKCLMIQLLEGTKYLHEHFIVHRDLKVSNLL-LTGKG-VLKIADFGL 181 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 37.9 bits (84), Expect = 0.008 Identities = 25/60 (41%), Positives = 36/60 (60%) Frame = +1 Query: 544 RVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 +++DED +L +F+ QI + VH+ ILH DLK +NIL L K +KI DFG+ Sbjct: 98 KLMDEDEILR-----LFV-QILLALRHVHKGQILHRDLKTQNIL-LNKKRKVVKIGDFGI 150 Score = 35.9 bits (79), Expect = 0.033 Identities = 20/79 (25%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXXXXXXXXXXXXXXLRHP 457 +NYE + +GRG +GTVYLCR + K +HP Sbjct: 2 QNYEKVRIVGRGAYGTVYLCRRLVDNFLVIIKQIPVEEMTKEERQSALNEVKVLSMFQHP 61 Query: 458 RLIQLYDAYDWGKYMCVYL 514 +I+ YD++ K + + + Sbjct: 62 NIIRYYDSFVQEKALMIVM 80 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/56 (28%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = +1 Query: 514 ELITGGELFERVIDEDFV---LTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 E GG L +R+ + + L+E + + Q+ +G++++H +++H+D+KP NI Sbjct: 214 EYCDGGSLADRIQSNNKLGERLSEADLKMLLLQLAQGLKYIHSLHLVHMDIKPGNI 269 >SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 565 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 VL E F RQI + ++H + H DLKPEN+L Sbjct: 147 VLEEDEARGFFRQIISAVAYIHEKGYAHRDLKPENLL 183 >SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +1 Query: 604 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 + EGI F+H Q ++H D+K +N+L +K NR KI D G Sbjct: 574 VVEGIRFLHSQGLVHRDIKLKNVLLDSK--NRGKITDLG 610 >SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) Length = 196 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 L+ V+ Q+ + +H + I+H DLKP N L + ++K+IDFG+ Sbjct: 32 LSSTHLAVYWEQMLRAVNVIHERGIVHSDLKPANFLFVDV---QLKLIDFGI 80 >SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) Length = 956 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 547 VIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLT 684 ++DE VL E +R++ +G+E+ H+ ++H D+K NIL T Sbjct: 794 LVDEG-VLEEDIIATVLREVLKGLEYFHKNGLIHRDVKAGNILLAT 838 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGN----RIKIIDFG 720 +I ++++H +NI+H DLKPEN+L T +K+ DFG Sbjct: 595 RILLALKYLHSKNIVHCDLKPENVLLAPITSECGYPAVKLCDFG 638 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/78 (25%), Positives = 38/78 (48%) Frame = +1 Query: 487 LGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPE 666 LG + + E G+L V D + + QI I+++H+ +I+H L+P+ Sbjct: 1005 LGSDFEVITEYFRDGDLLRHVRDGKCSSFDLVSA--LAQIAMVIQYIHQSDIVHCSLRPD 1062 Query: 667 NILCLTKTGNRIKIIDFG 720 NI+ + ++K+ FG Sbjct: 1063 NIMVAQQAPLKVKLTRFG 1080 >SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 2/69 (2%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXXXXXXXXXXXXXXLRHP 457 E +E L +IG G +G V+ CR K TG +A K L+HP Sbjct: 2 ERFEKLGKIGEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHP 61 Query: 458 RLIQLYDAY 484 L+ L + + Sbjct: 62 NLVNLLEVF 70 >SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 2/69 (2%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXXXXXXXXXXXXXXLRHP 457 E +E L +IG G +G V+ CR K TG +A K L+HP Sbjct: 2 ERFEKLGKIGEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHP 61 Query: 458 RLIQLYDAY 484 L+ L + + Sbjct: 62 NLVNLLEVF 70 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 583 CTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 C QI +E+ H + ++H DLKP NI +K+ DFGL Sbjct: 767 CFNVFEQIVNAVEYFHNRGMMHRDLKPSNI--FFSLDGLVKVGDFGL 811 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 36.3 bits (80), Expect = 0.025 Identities = 22/72 (30%), Positives = 36/72 (50%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 LLEL + L + ++ LTE FM+Q E ++H Q ++H D+K N Sbjct: 509 LLELCSRKSLVQ-MLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNF--FIN 565 Query: 688 TGNRIKIIDFGL 723 + +++ DFGL Sbjct: 566 SNMELRLGDFGL 577 >SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) Length = 239 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 E+ R + G++++ ++ ILH D+KPENIL Sbjct: 66 EKVARKIFRDVMRGVDYLDKRGILHNDIKPENIL 99 >SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) Length = 268 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 E+ R + G++++ ++ ILH D+KPENIL Sbjct: 158 EKVARKIFRDVMRGVDYLDKRGILHNDIKPENIL 191 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 36.3 bits (80), Expect = 0.025 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMR-QICEGIEFVHRQNILHLDLKPENILCLT 684 +L L+ GG+L V + E VF Q+ G+ +H Q I++ DLKPEN+L L Sbjct: 161 VLTLMNGGDLKFHVHNMGNPGFEEERAVFYAAQVTLGLIHLHSQRIVYRDLKPENLL-LD 219 Query: 685 KTGNRIKIIDFGL 723 G+ ++I D GL Sbjct: 220 DYGH-VRISDLGL 231 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 35.9 bits (79), Expect = 0.033 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTG--NRIKIIDF 717 + Q+C ++ +H I+H D+K +N+L G +R K+ DF Sbjct: 644 YWTQVCMAVDHIHTSGIIHKDIKAKNVLLCLNQGELHRAKLSDF 687 >SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 869 Score = 35.9 bits (79), Expect = 0.033 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +1 Query: 538 FERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDF 717 ++ V++ LT F QI +G+E++ + +H DL NI L N +KI DF Sbjct: 503 YDDVMEPAETLTLLNLMTFCYQIAKGMEYLASRKCIHRDLAARNI--LVADDNILKIADF 560 Query: 718 GL 723 GL Sbjct: 561 GL 562 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 35.9 bits (79), Expect = 0.033 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +1 Query: 583 CTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 C + Q+ +E +H + ++H D+KP N+ +T TG +K+ D GL Sbjct: 115 CRKYFVQLTAALEHMHSRRVMHRDIKPANVF-ITATG-VVKLGDLGL 159 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 35.9 bits (79), Expect = 0.033 Identities = 21/70 (30%), Positives = 38/70 (54%) Frame = +1 Query: 511 LELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKT 690 +E + GG + E + + E + M+ I E + ++H + ++HLDLK N+L +K Sbjct: 417 MEYMDGGSV-EMFLSNNGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNVLMDSK- 474 Query: 691 GNRIKIIDFG 720 +K+ DFG Sbjct: 475 -GIVKLADFG 483 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 35.5 bits (78), Expect = 0.044 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 F Q+ +G+E++ Q I+H DL NI L G K+ DFG+ Sbjct: 542 FAWQVADGMEYLSSQKIIHRDLAARNI--LVGEGEVCKVADFGM 583 >SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 35.5 bits (78), Expect = 0.044 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 7/67 (10%) Frame = +1 Query: 496 IYVRLLELITGGEL----FERV-IDEDFVLTERACTVFMRQICEGIEFVH--RQNILHLD 654 +Y+ + ELI G L FE DE L + RQ+C+ + ++H + +LH D Sbjct: 367 VYI-ISELIDGKNLDDILFEETDADESIALNMQDKFFVSRQLCQAVAYLHNLKPQVLHKD 425 Query: 655 LKPENIL 675 +KP N+L Sbjct: 426 IKPANVL 432 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 35.5 bits (78), Expect = 0.044 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +1 Query: 496 IYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLK-PEN 669 +Y ++E G+LFE V+ + +T + QI +G+ ++H I+H DLK P+N Sbjct: 171 VYCVVMEYCPYGQLFE-VLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPKN 228 >SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 35.5 bits (78), Expect = 0.044 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 E+ R + G++++ ++ ILH D+KPENIL Sbjct: 516 EKGARKIFRDVMRGVKYLDQRGILHNDIKPENIL 549 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 35.5 bits (78), Expect = 0.044 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +1 Query: 496 IYVRLLELITGGELFERVID-EDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 672 IY+ + EL+ G L + ++ E L E QI G+ F+ + N +H DL NI Sbjct: 327 IYI-VTELMKHGSLLDYLVKGEGQFLKEPTLIDMAAQIAAGMAFLEKMNYIHRDLAARNI 385 Query: 673 LCLTKTGNRIKIIDFGL 723 L K+ DFGL Sbjct: 386 --LVGENYACKVADFGL 400 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 35.1 bits (77), Expect = 0.058 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +1 Query: 595 MRQICEGIEFVHRQNILHLDLKPENILCL--TKTGNRIKIIDFG 720 ++Q+ + + ++H DLKPENI+ + K R+K+IDFG Sbjct: 204 VQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFRVKVIDFG 247 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 290 YEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 YE+L +GRG FG V C +K T +A K Sbjct: 98 YEVLEFLGRGTFGQVVKCWKKGTNELVAIK 127 >SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 35.1 bits (77), Expect = 0.058 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +1 Query: 589 VFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 ++M Q+ + ++H I H D+KP+N+L +T +K+ DFG Sbjct: 166 LYMYQLFRSLTYIHCLGICHRDIKPQNLLLDPETA-VLKLCDFG 208 >SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) Length = 282 Score = 35.1 bits (77), Expect = 0.058 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 +I + ++H I+HLDLKP N+L + G+ KI DFG Sbjct: 127 EISNALVYIHNSGIVHLDLKPANVL-IADDGS-CKIGDFG 164 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 35.1 bits (77), Expect = 0.058 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLT-KTGN--RIKIIDFG 720 QI + + ++H +++ DLKPENIL + G+ +K+IDFG Sbjct: 1622 QIADALAYLHTLGVIYRDLKPENILVWSLNEGDDLYVKLIDFG 1664 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 FM Q+ G+ ++ + +H DL N+ L ++ ++KI DFGL Sbjct: 271 FMIQVASGMAYLESKRFIHRDLAARNV--LLESNEKVKIGDFGL 312 >SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 + QI E++H ++++ DLKPEN+L K +K+ DFG Sbjct: 8 YASQIVLAFEYLHSLDLIYRDLKPENLLIDEK--GYLKVTDFG 48 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 ER V M Q+ ++ +H + I+H DL EN+L L GN I + +FG Sbjct: 1180 ERNVCVLMIQLFAALDHLHSEGIVHRDLNAENLL-LLDAGNLI-VANFG 1226 >SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 F I + +EF+H +H D+K N+L K G K+ DFG Sbjct: 23 FTTDILKAVEFMHGNGFIHNDIKGANVLVDDK-GRTAKLTDFG 64 >SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) Length = 216 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/58 (29%), Positives = 34/58 (58%) Frame = +1 Query: 502 VRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 V +++++ G E + D+ E A V MRQ + ++++H NI+HLD++ + I+ Sbjct: 116 VIMMDIVEGKNCLEFLGDKPRANEEDAAFV-MRQTLDALKYLHSNNIVHLDVRGDFII 172 Score = 33.5 bits (73), Expect = 0.18 Identities = 19/78 (24%), Positives = 32/78 (41%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRL 463 + Y E+ RGK+ + C+E T L AK L+H RL Sbjct: 44 KTYSFKGELARGKYAVIKRCQETKTKKNLVAK-LIKYDKDTEKIAVQEYEIMKDLKHDRL 102 Query: 464 IQLYDAYDWGKYMCVYLN 517 + + DA+ KY+ + ++ Sbjct: 103 LTVRDAFHVRKYVVIMMD 120 >SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) Length = 310 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 272 TDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 T N+ +G G FG VY+C + TG ELA K Sbjct: 184 TQFPNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVK 219 >SB_37212| Best HMM Match : zf-C2H2 (HMM E-Value=2e-23) Length = 827 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDL 657 + E + GG L E +++ + L R I G+ F+H++ LH DL Sbjct: 359 ITEFVNGGNLEELLMNHEETLNWATRVYLARDIASGMAFLHQKRFLHRDL 408 >SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRI-KIIDFGL 723 +ED ++ F Q+ +G+E++ R+ +H DL N+L N++ K+ DFGL Sbjct: 723 EEDDGISSGDLMAFAWQVAQGMEYLARRGFVHRDLAARNVLV---GDNKVAKVADFGL 777 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 F Q+ G+E++ + +H DL N+ L + IKI DFGL Sbjct: 585 FSYQVARGMEYLESKKCIHRDLAARNV--LVSDNHVIKIADFGL 626 >SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 33.5 bits (73), Expect = 0.18 Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 4/84 (4%) Frame = +1 Query: 484 RLGEIYVRLLELITGG--ELFERVIDE-DFVLTERACTVFMRQICEGIEFVHRQ-NILHL 651 R G++++ +EL+ +L+++V + D + E + +E++H ++H Sbjct: 95 REGDVWI-CMELMKTSLYDLYKQVFSKPDRRIPEEVLGKIAVSVVSALEYLHSNLKVIHR 153 Query: 652 DLKPENILCLTKTGNRIKIIDFGL 723 D+KP NIL + + GN K+ DFG+ Sbjct: 154 DVKPSNIL-VDERGN-FKLCDFGI 175 >SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +1 Query: 559 DFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 +F L ++ + QI +G++F+ + +H DL N+ L G +KI DFGL Sbjct: 457 EFTLADQVVDAY--QIAQGMDFLASKKCIHRDLAARNV--LVDEGYALKIGDFGL 507 >SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) Length = 436 Score = 33.5 bits (73), Expect = 0.18 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVH--RQNILHLDLKPENILCLTKTG---NRIKIIDF 717 D DF+L + TV R+ +++++ + ++H DLKP NIL L TG KI DF Sbjct: 241 DLDFLLKQHK-TVPERETVRALKYLNEIKPPVIHYDLKPGNIL-LVGTGAFSGETKITDF 298 Query: 718 GL 723 GL Sbjct: 299 GL 300 >SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 387 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 D++ LT+ Q+ G+E + +H DL N CL G +KI DFG+ Sbjct: 58 DKEKSLTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRN--CLVGDGLVVKIADFGM 112 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 D++ LT+ Q+ G+E + +H DL N CL G +KI DFG+ Sbjct: 241 DKEKSLTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRN--CLVGDGLVVKIADFGM 295 >SB_56790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 28 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTG 361 ENY +L IG G FG VY R K TG Sbjct: 2 ENYHILELIGEGSFGKVYKGRRKYTG 27 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 33.1 bits (72), Expect = 0.24 Identities = 17/65 (26%), Positives = 36/65 (55%) Frame = +1 Query: 526 GGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIK 705 GG+L + ++ + E+ + ++ ++ +H +H D+KP+N+L L G+ +K Sbjct: 120 GGDLVNLM--SNYEIPEKWAKFYCAEVVLALDAIHTMGFVHRDVKPDNML-LDGEGH-LK 175 Query: 706 IIDFG 720 + DFG Sbjct: 176 LADFG 180 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 QI +G+ ++H + I+H DL+ +N+ + ++ I DFGL Sbjct: 119 QIAQGMGYLHARGIVHTDLRSKNV--FLELNSKAVITDFGL 157 >SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 33.1 bits (72), Expect = 0.24 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 4/65 (6%) Frame = +1 Query: 493 EIYVRLLELITG---GELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQ-NILHLDLK 660 ++Y+ ++EL+ G GE F + ++ +E QI G+ ++H++ +I+H DL Sbjct: 274 KLYI-IMELVEGAPLGEHFNSLKEKGTRFSEERIWHIFIQIVLGLRYIHKEKHIVHRDLT 332 Query: 661 PENIL 675 P NI+ Sbjct: 333 PNNIM 337 >SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1460 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/36 (36%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +1 Query: 616 IEFVHRQNILHLDLKPENILCL-TKTGNRIKIIDFG 720 ++ +H +++H DLKP+N+L L ++ +++IDFG Sbjct: 1286 LQTMHACDVIHGDLKPDNVLVLESENSVALRLIDFG 1321 >SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 QI G+ ++ N +H DL NIL K N +KI DFGL Sbjct: 346 QIAAGMAYLEINNYIHRDLAARNILVGEK--NIVKIADFGL 384 Score = 27.9 bits (59), Expect = 8.9 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +2 Query: 254 FTIKRNTDV-NENYEMLSEIGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXX 430 F +K ++ E+ +LS++G+G+FG V+ +T +A K Sbjct: 231 FNMKDQWEIPRESVRILSKLGQGQFGEVWEGLWNNT-TPVAVK-MLRPGTMSASAFLAEA 288 Query: 431 XXXXXLRHPRLIQLY 475 LRHP+L+QLY Sbjct: 289 QIMKKLRHPKLVQLY 303 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 33.1 bits (72), Expect = 0.24 Identities = 19/75 (25%), Positives = 35/75 (46%) Frame = +1 Query: 499 YVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC 678 ++ ++EL+ GG+ + + F G+E++ +N +H DL N C Sbjct: 655 FISVMELMLGGDFLTYLRKHLGKIQVPRLVKFSIHAAAGMEYLASKNCIHRDLAARN--C 712 Query: 679 LTKTGNRIKIIDFGL 723 L + +KI DFG+ Sbjct: 713 LIGEDDVLKISDFGM 727 >SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) Length = 150 Score = 33.1 bits (72), Expect = 0.24 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = +1 Query: 604 ICEGIEFVHRQNILHLDLKPENILCLT-KTGNRI--KIIDFGL 723 + EG+ ++H+ I++ DLKP NIL + G I KI D+G+ Sbjct: 1 VAEGLAYLHKHMIVYRDLKPHNILIFSLSLGILINAKISDYGI 43 >SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 196 Score = 33.1 bits (72), Expect = 0.24 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 DE F LT+ T F Q+ ++F+ + +H DL N+ L +KI DFGL Sbjct: 59 DETFTLTDLVITSF--QVSRAMQFLASRRCVHRDLAARNV--LVGENYVMKIADFGL 111 >SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1063 Score = 32.7 bits (71), Expect = 0.31 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 D L++ Q+ G+E+V +H DL N CL T +KI DFG+ Sbjct: 936 DAKVFLSKEDLVGIAEQVAAGMEYVASLRFVHRDLATRN--CLVGTDMVVKIADFGM 990 >SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 646 HLDLKPENILCLTKTGN-RIKIIDFGL 723 H DLKPEN+L +K N +K+ DFGL Sbjct: 21 HRDLKPENLLLASKEKNAAVKLADFGL 47 >SB_25981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGI 618 +LEL+TGGELF+RV+++ + + A ++ I E + Sbjct: 29 VLELVTGGELFDRVVEKGYYCEKDAADA-IKMILEAV 64 >SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 786 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +1 Query: 595 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 M Q+ +G+ ++H I+H DL NI L + KI DFGL Sbjct: 1 MLQVVKGVLYLHSHGIIHRDLSLGNI--LLSSDMDAKIADFGL 41 >SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 Q+ + ++ N +H DL N CL N +K+ DFGL Sbjct: 322 QVGSAMSYLESMNFIHRDLAARN--CLVGDNNLVKVADFGL 360 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 31.9 bits (69), Expect = 0.54 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENIL 675 Q+ ++F+H + H DLKPEN+L Sbjct: 818 QLIVAVKFLHEMKLTHTDLKPENML 842 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 31.9 bits (69), Expect = 0.54 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +1 Query: 550 IDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 ++++ ++ER F+ + G++ +H ++H+D+KP N+ KI DFGL Sbjct: 566 LEKNDSVSEREVWNFLLDLTLGLKHLHDSGMVHMDIKPANV--FFGHDGLCKIGDFGL 621 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 31.9 bits (69), Expect = 0.54 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +1 Query: 550 IDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC--LTKTGNRIKIIDFG 720 + E+ L + +++ +G+ ++H + I+H D+K NIL + ++K+ DFG Sbjct: 297 VAEEICLPWKDRAFVIKEAAKGLSYLHNKGIVHSDIKTCNILVGESSSEAYKVKLGDFG 355 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 31.9 bits (69), Expect = 0.54 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 565 VLTERACTVFMRQICEGIEFVHR--QNILHLDLKPENILCLTKTG-NRIKIIDFGL 723 +L E T+ M + G+ ++H Q +H DL P+NIL L K KI D GL Sbjct: 107 LLLEEVVTI-MLDVANGLNYLHTRIQPTIHRDLCPKNILILKKDSVITAKITDVGL 161 >SB_6976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.54 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 281 NENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 ++ YE+ E+G+G F V C K + +E AAK Sbjct: 10 HDTYELKEELGKGAFSIVRRCIHKESRIEYAAK 42 >SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 31.9 bits (69), Expect = 0.54 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +1 Query: 550 IDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC--LTKTGNRIKIIDFG 720 + E+ L + +++ +G+ ++H + I+H D+K NIL + ++K+ DFG Sbjct: 278 VAEEICLPWKDRAFVIKEAAKGLSYLHNKGIVHSDIKTCNILVGESSSEAYKVKLGDFG 336 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 31.5 bits (68), Expect = 0.72 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 553 DEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 D D T+ Q+ G+EF+ + +H DL N+ L +K+ DFGL Sbjct: 529 DHDVQFTQMELVSAAYQVARGMEFLASRRCIHRDLAARNV--LIADDYVLKVADFGL 583 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.1 bits (67), Expect = 0.95 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 529 GELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLK 660 G + E I + L E + RQI EGI ++H I+H D+K Sbjct: 1 GSIHEH-IKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 43 >SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1565 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 QI +G+EF+ R+ +H DL N+ L +K+ DFGL Sbjct: 1245 QISKGMEFLARKKCVHRDLAARNV--LVGPDYVMKVSDFGL 1283 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/28 (42%), Positives = 23/28 (82%), Gaps = 2/28 (7%) Frame = +1 Query: 610 EGIEFVHRQ-NILHLDLKPENI-LCLTK 687 +G++++H + I+H D+KPENI LC+++ Sbjct: 157 KGLDYLHTKCKIIHTDIKPENILLCISQ 184 >SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 931 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK 687 + E + G L + D LT R + G+ ++ N +H DL NI L Sbjct: 648 ITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNI--LVS 705 Query: 688 TGNRIKIIDFGL 723 K+ DFGL Sbjct: 706 DNLAAKVSDFGL 717 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 577 RACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 +A + +Q+ ++ + R ILH D+KP+NIL Sbjct: 766 KAVRSYSQQLFLALKLMKRTGILHADIKPDNIL 798 >SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/69 (27%), Positives = 31/69 (44%) Frame = +1 Query: 454 PSTDPTVRRLRLGEIYVRLLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHR 633 P T R + + LLE GGEL+ + D + + + EG E++H Sbjct: 29 PRTQWIYRTFKDRKYVYMLLEACLGGELWTILRDRG-TFEDATARFCIACVVEGFEYLHS 87 Query: 634 QNILHLDLK 660 + I++ DLK Sbjct: 88 KGIVYRDLK 96 >SB_51639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 85 CLDCSVPVDVQLSGNINIISDARECNVNSFIEDHQK 192 C DCS P++ +L G N I D R + + K Sbjct: 52 CADCSAPIETELQGVRNYIDDIRGDQERKYAQKRDK 87 >SB_28514| Best HMM Match : MazG (HMM E-Value=6) Length = 137 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 266 RNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 R+ D +++++ IG G +G VY R TG AAK Sbjct: 49 RSLDPPVDWQLVESIGEGTYGEVYKVRNVKTGEIAAAK 86 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 601 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI---IDFGL 723 QI + ++ +H LH D+KP N + T + + I +DFGL Sbjct: 31 QILKSVKSIHEAGFLHRDIKPSN-FAMGNTPDTVHICYMLDFGL 73 >SB_17544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 E YE L +G G +G V CR K + +A K Sbjct: 112 EKYENLGLVGEGSYGMVMKCRHKDSNQIVAIK 143 >SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) Length = 256 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 604 ICEGIEFVHRQNILHLDLKPENILCLTKTGN-RIKIIDF 717 + + + F+H + +H DLK N++ + GN IIDF Sbjct: 187 VADALHFIHGRGFVHNDLKGNNVVLEGEAGNFNPMIIDF 225 >SB_51537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 78 RHVS*LFCASGCSAQWKYQYNIGCARV*CEFVHRR 182 RHV G S W+YQ NI R C+ V RR Sbjct: 116 RHVRGQTQGEGGSQYWRYQENIPVRRTRCKLVFRR 150 >SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) Length = 267 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 +TE+ F +I +G+ + ++ +H DL NI L N + DFGL Sbjct: 179 MTEKEKFKFAYEIAKGMRHLEKKKCVHRDLAARNI--LLNVDNVAMVSDFGL 228 >SB_46446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.5 bits (63), Expect = 2.9 Identities = 8/36 (22%), Positives = 23/36 (63%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 + E ++++ +G++++HR +I+H +K ++L Sbjct: 68 MPEALIAAILKEVLQGLDYLHRMSIIHRGMKGGHVL 103 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/70 (28%), Positives = 29/70 (41%) Frame = +1 Query: 514 ELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTG 693 E + G L + D LT R + G++++ N +H DL NI L Sbjct: 523 EFMENGSLDHFLKSNDGRLTVFQLLGMARGVAAGMDYLSSINFIHRDLAARNI--LVSEN 580 Query: 694 NRIKIIDFGL 723 K+ DFGL Sbjct: 581 MTTKVSDFGL 590 >SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) Length = 602 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 568 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 +TE+ F +I +G+ + ++ +H DL NI L N + DFGL Sbjct: 514 MTEKEKFKFAYEIAKGMRHLEKKKCVHRDLAARNI--LLNVDNVAMVSDFGL 563 >SB_25961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 281 NENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 N+++E ++E+G G G V K TGL +A K Sbjct: 67 NDDFEKITELGAGNGGVVTKVLHKPTGLIMARK 99 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 239 VPVSRFTIKRNTDVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 +P+ I+ + + YE +GRG FG V + TG A K Sbjct: 10 LPIKHTRIEDEKQIEDVYEFGQVLGRGSFGVVNEAKHIETGTRWAIK 56 >SB_31358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 29.1 bits (62), Expect = 3.8 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 6/81 (7%) Frame = +1 Query: 478 RLRLGEIYVRLLELIT---GGELFER---VIDEDFVLTERACTVFMRQICEGIEFVHRQN 639 +L+ + +L+E++T G +E+ V+D L + F + +GIEF+ Sbjct: 478 KLQFEMFFKKLMEILTMDMQGVHYEKRELVLDAINQLLQAGSEHFNNKPKKGIEFLQEHG 537 Query: 640 ILHLDLKPENILCLTKTGNRI 702 +LH L PE + L + R+ Sbjct: 538 LLHTPLDPEEMARLLRENPRL 558 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 F QI G+E++ + +H DL NI L +KI DFGL Sbjct: 854 FAFQIARGMEYLSFKKCIHRDLAARNI--LVGEDYVMKIADFGL 895 >SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) Length = 735 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 275 DVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 D + Y L EIG G FG VY R T +A K Sbjct: 457 DPEKIYADLREIGHGSFGAVYYARNVRTNEVVAIK 491 >SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) Length = 385 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKT-GNRIKIIDFG 720 + +C + + Q+ G+ + + H DLK +N+L T R+ I DFG Sbjct: 97 QTSCLLLL-QLLNGLVHLQEHQVAHRDLKSDNLLLDTSVYPPRLVICDFG 145 >SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 290 YEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 YE+L +G+G FG V + TG +A K Sbjct: 287 YEVLEVLGKGSFGQVVKALDHKTGQHVAVK 316 >SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) Length = 1019 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 598 RQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDF 717 RQ+ G+ ++ I+H +L EN CL R+KI F Sbjct: 369 RQVLTGMAYLEESGIVHGELVAEN--CLVGDNGRVKISGF 406 >SB_19037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +1 Query: 640 ILHLDLKPENILCLTKTG--NRIKIIDFG 720 ++H DLKP NI+ +G ++I+DFG Sbjct: 1 VVHRDLKPSNIMYADDSGTPESLRIVDFG 29 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/56 (21%), Positives = 33/56 (58%) Frame = +1 Query: 508 LLELITGGELFERVIDEDFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 +++L+ GG++ + + + E +++ ++ + ++ + I+H DLKP+N+L Sbjct: 4187 VVDLLLGGDIRYH-LQQGMRVDENRVKLYICELGLALGYLRSKKIVHRDLKPDNML 4241 >SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1554 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 586 TVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 723 T+ Q+ G+EF+ + +H DL N+ L +K+ DFGL Sbjct: 949 TMASYQVSRGVEFLASRKCVHRDLAARNV--LVGPDYVMKVSDFGL 992 >SB_24054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/76 (26%), Positives = 29/76 (38%), Gaps = 5/76 (6%) Frame = +2 Query: 284 ENYEMLSEIGRGKFGTVYLCREKSTGLELAAK-----XXXXXXXXXXXXXXXXXXXXXXL 448 E YE+L IGRG F VY G +A K L Sbjct: 138 ETYELLHLIGRGGFAMVYAGTRVRDGKPVAIKVIPKNNVYFFEEVEGISVPMEVYLHRVL 197 Query: 449 RHPRLIQLYDAYDWGK 496 HP +++LYD +++ + Sbjct: 198 DHPNVVRLYDYFEYNQ 213 >SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 595 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 ++ I E + F H++ LH DLK N++ + +ID+G Sbjct: 343 LKTIAETLLFCHQKGFLHNDLKQNNVVFHYSGSWKPVVIDWG 384 >SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) Length = 208 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 E+ TV + + G++ +H+ ++ DLKP+N++ Sbjct: 49 EQRLTV-AKDVARGLQKIHKAEYVYRDLKPQNVM 81 >SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 28.3 bits (60), Expect = 6.7 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +1 Query: 610 EGIEFVHRQNILHLDLKPENIL 675 + ++F H + I+H D+KP N++ Sbjct: 472 KALDFCHSRGIMHRDVKPHNVM 493 >SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) Length = 634 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +1 Query: 574 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 675 E+ TV + + G++ +H+ ++ DLKP+N++ Sbjct: 547 EQRLTV-AKDVARGLQKIHKAEYVYRDLKPQNVM 579 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 Query: 592 FMRQICEGIEFVHRQNILHLDLKPENIL 675 F QI +G+E++ ++++H DL N+L Sbjct: 151 FSLQIADGMEYLANRHLVHRDLAARNVL 178 >SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1626 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 499 IFPPVVSVVQLDQSRVPESSHHVHLP 422 + PPV V Q + R P++ HH LP Sbjct: 1459 VVPPVEQVFQTSKRRPPQAQHHHVLP 1484 >SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 604 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 720 +CEG+ + I+H DL NIL L N K+ DFG Sbjct: 164 VCEGLVHIAECGIIHGDLAARNIL-LDSHANP-KLADFG 200 >SB_42225| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 300 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 239 VPVSRFTIKRNTDVNENYEMLSEIGRGKFGTVY 337 +PV T + ++ E+ +L E+G G +G VY Sbjct: 4 MPVIVKTTSKIREIKESLRLLKELGEGDYGKVY 36 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 275 DVNENYEMLSEIGRGKFGTVYLCREKSTGLELAAK 379 + +E Y L IG+G FG V + R ++ E+ K Sbjct: 581 EYDEKYLTLKSIGKGAFGFVQMARRRADMSEVVVK 615 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,748,645 Number of Sequences: 59808 Number of extensions: 435627 Number of successful extensions: 1372 Number of sequences better than 10.0: 183 Number of HSP's better than 10.0 without gapping: 1163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1348 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -