BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20843 (732 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) riboso... 147 8e-36 At5g07090.1 68418.m00804 40S ribosomal protein S4 (RPS4B) 147 8e-36 At2g17360.1 68415.m02005 40S ribosomal protein S4 (RPS4A) contai... 147 8e-36 At4g10710.1 68417.m01751 transcriptional regulator-related simil... 31 0.79 At1g29760.1 68414.m03639 expressed protein 31 0.79 At1g15780.1 68414.m01893 expressed protein 30 1.4 At5g16910.1 68418.m01982 cellulose synthase family protein simil... 29 2.4 At5g63000.1 68418.m07904 expressed protein 29 3.2 At3g03050.1 68416.m00301 cellulose synthase family protein (CslD... 29 3.2 At2g38050.1 68415.m04671 3-oxo-5-alpha-steroid 4-dehydrogenase, ... 29 3.2 At1g02730.1 68414.m00226 cellulose synthase family protein simil... 29 3.2 At5g63860.1 68418.m08016 UVB-resistance protein (UVR8) identical... 29 4.2 At1g67870.1 68414.m07750 glycine-rich protein contains non-conse... 28 5.6 At4g38190.1 68417.m05391 cellulose synthase family protein simil... 28 7.3 At2g40760.1 68415.m05028 rhodanese-like domain-containing protei... 28 7.3 At4g08180.3 68417.m01353 oxysterol-binding family protein simila... 27 9.7 At4g08180.2 68417.m01352 oxysterol-binding family protein simila... 27 9.7 At4g08180.1 68417.m01351 oxysterol-binding family protein simila... 27 9.7 At3g56260.1 68416.m06252 expressed protein 27 9.7 >At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) ribosomal protein S4, Arabidopsis thaliana, PIR:T48480 Length = 262 Score = 147 bits (356), Expect = 8e-36 Identities = 66/85 (77%), Positives = 75/85 (88%) Frame = +3 Query: 3 HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 182 HLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT EV+ I+ Q Sbjct: 8 HLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQ 67 Query: 183 RLIKVDGKVRTDPTYPAGFMDVVSL 257 R I+VDGKVRTD TYPAGFMDVVS+ Sbjct: 68 RHIQVDGKVRTDKTYPAGFMDVVSI 92 Score = 128 bits (308), Expect = 5e-30 Identities = 57/90 (63%), Positives = 70/90 (77%) Frame = +2 Query: 254 IEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 433 I KTNE FRL+YD KGRF +H I EEAK+KLCKV+ + G K +PYL T+DGRTIRYPD Sbjct: 92 IPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPD 151 Query: 434 PLIKVNDSIQLDIATTKIMDFIKFEPGTCV 523 PLIK ND+I+LD+ KI++FIKF+ G V Sbjct: 152 PLIKPNDTIKLDLEANKIVEFIKFDVGNVV 181 Score = 118 bits (283), Expect = 5e-27 Identities = 51/74 (68%), Positives = 63/74 (85%) Frame = +1 Query: 511 GNLCMITGGRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYIS 690 GN+ M+TGGRN GRVG I +RE+H GSF+ +HI+DSTGH FATRL NV+ IGKGTK ++S Sbjct: 178 GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVS 237 Query: 691 LPRGKGIRLTIAEE 732 LP+GKGI+LTI EE Sbjct: 238 LPKGKGIKLTIIEE 251 >At5g07090.1 68418.m00804 40S ribosomal protein S4 (RPS4B) Length = 262 Score = 147 bits (356), Expect = 8e-36 Identities = 66/85 (77%), Positives = 75/85 (88%) Frame = +3 Query: 3 HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 182 HLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT EV+ I+ Q Sbjct: 8 HLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQ 67 Query: 183 RLIKVDGKVRTDPTYPAGFMDVVSL 257 R I+VDGKVRTD TYPAGFMDVVS+ Sbjct: 68 RHIQVDGKVRTDKTYPAGFMDVVSI 92 Score = 127 bits (307), Expect = 7e-30 Identities = 57/90 (63%), Positives = 70/90 (77%) Frame = +2 Query: 254 IEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 433 I KTNE FRL+YD KGRF +H I EEAK+KLCKV+ + G K +PYL T+DGRTIRYPD Sbjct: 92 IPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPD 151 Query: 434 PLIKVNDSIQLDIATTKIMDFIKFEPGTCV 523 PLIK ND+I+LD+ KI++FIKF+ G V Sbjct: 152 PLIKPNDTIKLDLEENKIVEFIKFDVGNVV 181 Score = 118 bits (283), Expect = 5e-27 Identities = 51/74 (68%), Positives = 63/74 (85%) Frame = +1 Query: 511 GNLCMITGGRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYIS 690 GN+ M+TGGRN GRVG I +RE+H GSF+ +HI+DSTGH FATRL NV+ IGKGTK ++S Sbjct: 178 GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVS 237 Query: 691 LPRGKGIRLTIAEE 732 LP+GKGI+LTI EE Sbjct: 238 LPKGKGIKLTIIEE 251 >At2g17360.1 68415.m02005 40S ribosomal protein S4 (RPS4A) contains ribosomal protein S4 signature from residues 8 to 22 Length = 261 Score = 147 bits (356), Expect = 8e-36 Identities = 66/85 (77%), Positives = 75/85 (88%) Frame = +3 Query: 3 HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 182 HLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT EV+ I+ Q Sbjct: 8 HLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQ 67 Query: 183 RLIKVDGKVRTDPTYPAGFMDVVSL 257 R I+VDGKVRTD TYPAGFMDVVS+ Sbjct: 68 RHIQVDGKVRTDKTYPAGFMDVVSI 92 Score = 127 bits (307), Expect = 7e-30 Identities = 57/90 (63%), Positives = 70/90 (77%) Frame = +2 Query: 254 IEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 433 I KTNE FRL+YD KGRF +H I EEAK+KLCKV+ + G K +PYL T+DGRTIRYPD Sbjct: 92 IPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPD 151 Query: 434 PLIKVNDSIQLDIATTKIMDFIKFEPGTCV 523 PLIK ND+I+LD+ KI++FIKF+ G V Sbjct: 152 PLIKPNDTIKLDLEENKIVEFIKFDVGNVV 181 Score = 118 bits (283), Expect = 5e-27 Identities = 51/74 (68%), Positives = 63/74 (85%) Frame = +1 Query: 511 GNLCMITGGRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYIS 690 GN+ M+TGGRN GRVG I +RE+H GSF+ +HI+DSTGH FATRL NV+ IGKGTK ++S Sbjct: 178 GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVS 237 Query: 691 LPRGKGIRLTIAEE 732 LP+GKGI+LTI EE Sbjct: 238 LPKGKGIKLTIIEE 251 >At4g10710.1 68417.m01751 transcriptional regulator-related similar to chromatin-specific transcription elongation factor FACT 140 kDa subunit (GI:5499741) [Homo sapiens] Length = 1074 Score = 31.1 bits (67), Expect = 0.79 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 106 KHSRNLWGPVDGLGAYTPPSLSNIHAL 26 KHS +LWG D L TPP+ ++ L Sbjct: 44 KHSADLWGSADALAIATPPASDDLRYL 70 >At1g29760.1 68414.m03639 expressed protein Length = 526 Score = 31.1 bits (67), Expect = 0.79 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 217 SVLTFPSTFMRRCFTIFRTSFPVKAYFRRFL 125 S+LTFP +R CF F F + RRFL Sbjct: 195 SLLTFPPWLLRNCFLFFFDPFSTIRFGRRFL 225 >At1g15780.1 68414.m01893 expressed protein Length = 1335 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = -1 Query: 705 LAARQRDVRLRALADYEHVVQPRGEGVSRGVLDVHNVEG 589 L ARQ+ +L+ + D + +G VSRG+ H+++G Sbjct: 865 LQARQQAAQLQQMNDMNDLTSRQGMNVSRGMFQQHSMQG 903 >At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulose synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays Length = 1145 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 671 PLPIMNTLFNLVAKVCPVESLMCTMSKEPGCL 576 PL NT+ +++A PVE L C +S + G L Sbjct: 395 PLVTANTILSILAAEYPVEKLSCYVSDDGGAL 426 >At5g63000.1 68418.m07904 expressed protein Length = 201 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/48 (39%), Positives = 24/48 (50%) Frame = -1 Query: 624 SRGVLDVHNVEGAGMSLAGHDGAHTPQVTASRDHTQVPGSNLMKSIIF 481 +RGV DV NV GAG + A G P A R + GS L ++ F Sbjct: 110 TRGVHDVFNVVGAGSATAAVFGLIMPGSLAWRARNVLLGSVLGATVCF 157 >At3g03050.1 68416.m00301 cellulose synthase family protein (CslD3) similar to cellulose synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-7 (gi:9622886) from Zea mays; contains Pfam profile PF03552: Cellulose synthase Length = 1145 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 671 PLPIMNTLFNLVAKVCPVESLMCTMSKEPGCL 576 PL NT+ +++A PVE L C +S + G L Sbjct: 392 PLVTSNTILSILAADYPVEKLACYVSDDGGAL 423 >At2g38050.1 68415.m04671 3-oxo-5-alpha-steroid 4-dehydrogenase, putative / steroid 5-alpha-reductase, putative identical to gi:1280611; contains a steroid 5-alpha reductase, C-terminal domain Length = 262 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 196 TFMRRCFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGP 80 TF R C + P A +FL+ GKH+R WGP Sbjct: 8 TFFRYCLLTLIFAGPPTAVLLKFLQA-PYGKHNRTGWGP 45 >At1g02730.1 68414.m00226 cellulose synthase family protein similar to cellulose synthase catalytic subunit [gi:13925881] from Nicotiana alata, cellulose synthase-4 [gi:9622880] from Zea mays Length = 1181 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 671 PLPIMNTLFNLVAKVCPVESLMCTMSKEPGCL 576 PL NT+ +++A PVE L C +S + G L Sbjct: 416 PLVTANTILSILAVDYPVEKLACYLSDDGGAL 447 >At5g63860.1 68418.m08016 UVB-resistance protein (UVR8) identical to UVB-resistance protein UVR8 (GI:5478530, GB:AAD43920.1) [Arabidopsis thaliana]; contains Pfam 00415: Regulator of chromosome condensation (RCC1) Length = 440 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 535 GRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFA-TRLNNVFIIGKGTKAYISL 693 G NL + + + R P +V + HT A T NNVF G+GT + + Sbjct: 311 GNNLDQCSPV--QVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGI 362 >At1g67870.1 68414.m07750 glycine-rich protein contains non-consensus GG donor splice site at exon2; modeled to est match. Length = 279 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 606 HQGLHGTHLR--HEVEQRVHNRQGHEGVHLAAARQGHPPHHRRG 731 HQG+HG + H ++ + + H+G+H + GH H+ G Sbjct: 154 HQGMHGMQHQGGHGMQHQGGHGMQHQGMHGMQHQGGHGMEHQGG 197 >At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays Length = 1111 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 671 PLPIMNTLFNLVAKVCPVESLMCTMSKEPGCL 576 PL NT+ +++A PVE + C +S + G L Sbjct: 370 PLVTANTILSILAVDYPVEKVSCYLSDDGGAL 401 >At2g40760.1 68415.m05028 rhodanese-like domain-containing protein contains rhodanese-like domain PF00581 Length = 474 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 711 DALAARQRDVRLRALADYEHVVQPRGEGVSRG 616 + LA QRDVRL L E V P E + G Sbjct: 158 EVLAFIQRDVRLNGLRQVETPVSPEQEAIHHG 189 >At4g08180.3 68417.m01353 oxysterol-binding family protein similar to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 813 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 129 NRLKYALTGNEVLKIVKQRLIKVDGKVRTDPTY 227 N ++A+T NE+ +K+RL D ++R D Y Sbjct: 703 NLTRFAITLNELTPGLKERLPPTDSRLRPDQRY 735 >At4g08180.2 68417.m01352 oxysterol-binding family protein similar to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 813 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 129 NRLKYALTGNEVLKIVKQRLIKVDGKVRTDPTY 227 N ++A+T NE+ +K+RL D ++R D Y Sbjct: 703 NLTRFAITLNELTPGLKERLPPTDSRLRPDQRY 735 >At4g08180.1 68417.m01351 oxysterol-binding family protein similar to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 814 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 129 NRLKYALTGNEVLKIVKQRLIKVDGKVRTDPTY 227 N ++A+T NE+ +K+RL D ++R D Y Sbjct: 704 NLTRFAITLNELTPGLKERLPPTDSRLRPDQRY 736 >At3g56260.1 68416.m06252 expressed protein Length = 176 Score = 27.5 bits (58), Expect = 9.7 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Frame = +1 Query: 412 PHHPLSRPTYQSQRFHPVRHCNYEDYGLHQV*AGNLCMITGGRNLGRVGTI--VSRERHP 585 P H L + ++ P+ + NYE+ L LC GGR LG ++ V+R Sbjct: 95 PPHSLKKRMSHDKK-SPLLYANYEEDELRSSPTSTLCCSNGGR-LGCSSSMGSVTRALFS 152 Query: 586 GSFDIVHIKDSTG 624 GS + + ++TG Sbjct: 153 GSMEGMKRHETTG 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,162,532 Number of Sequences: 28952 Number of extensions: 412048 Number of successful extensions: 1214 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -