BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20841 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 34 0.004 AY748836-1|AAV28184.1| 89|Anopheles gambiae cytochrome P450 pr... 23 7.0 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 9.2 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 34.3 bits (75), Expect = 0.004 Identities = 23/61 (37%), Positives = 32/61 (52%) Frame = -1 Query: 313 NIVITNLHVKAHLMSNFRSLGISSDLALAMNNKIPKAIVRVPMIKTSLVRFLAIFTKFVS 134 N+V+ NL + A L+SNF S +S+ A NKI +A R+ + LA KFV Sbjct: 1018 NLVVLNLFL-ALLLSNFGSSSLSAPTADNETNKIAEAFNRISRFSNWIKMNLANALKFVK 1076 Query: 133 N 131 N Sbjct: 1077 N 1077 >AY748836-1|AAV28184.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 116 NLRYKIRNLI*KPSQFTILL 57 N+RY+ RNLI +P +LL Sbjct: 2 NIRYRERNLIKRPDFIHLLL 21 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 559 MANAGKDTNGSQFFITTVKTPWLD 630 ++N KDT G QF+ +K WLD Sbjct: 323 LSNTFKDTTGQQFY-DNIKR-WLD 344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,520 Number of Sequences: 2352 Number of extensions: 13685 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -