BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20839 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 24 3.9 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 6.8 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 9.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 9.0 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 172 YLSWCSEHYHV*FDCFQII*NII 240 Y S C YH+ + CF+ + N+I Sbjct: 246 YGSPCKRAYHLLYKCFENVRNVI 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 154 CKLLGTYLSWCSEHYHV*F 210 CKL G ++ HYHV F Sbjct: 502 CKLCGKVVTHIRNHYHVHF 520 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 172 YLSWCSEHYHV 204 + SW EHYHV Sbjct: 63 HFSWTMEHYHV 73 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 551 INIIVLWDC*LKTKPITFYAKINTTLTNLASLKNLNTVNNSALNE 685 + I+V+ L P + K+N LT L L V+ A+NE Sbjct: 272 LQIVVVCPALLGLSPSLLHTKLNALLTPNRVLGMLLDVSECAVNE 316 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,651 Number of Sequences: 2352 Number of extensions: 12783 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -