BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20839 (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 0.51 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.2 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 24 1.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 1.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 1.2 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 4.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 4.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 4.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 4.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 4.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 4.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 4.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 4.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 4.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 4.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 4.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 4.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 4.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 4.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 4.8 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 6.3 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.3 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 6.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 8.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 8.3 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 25.4 bits (53), Expect = 0.51 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 500 SKSI*TFQGIL*FTKNNINIIVLWDC*LKTKPITF--YAKINTTL 628 S I T G+ FT+ N N I WD + P TF A+ NTT+ Sbjct: 301 SSVIDTNTGVDYFTQINRNGIACWDTNTELNPNTFILVAENNTTM 345 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYN 102 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYN 335 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYN 335 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 92 KIISNGSGF*HNLEYNNHASHAN 160 KIISN + +N YNN+ ++ N Sbjct: 80 KIISNNNPLSNNYNYNNNYNNYN 102 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P V +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIVSSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 56 YREYRETSRERSRDR-RERG 74 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 289 YRKYRETSKERSRDR-RERG 307 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 305 YREYRETSRERSRDR-RERG 323 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 71 NKVPISVKIISNGSGF*HNLEYNNHASHANY 163 +K P + +SN + + YNN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNYNNNNNYNNY 106 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 397 YPVYRQTKLKRSRD--ELRTRGAP*ILISVNVSS*LFEKYLN 516 Y YR+T +RSRD E P I+ S++ S Y N Sbjct: 278 YRKYRETSKERSRDRRERERSKEPKIISSLSNSCNYSNNYYN 319 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 397 YPVYRQTKLKRSRDELRTRG 456 Y YR+T +RSRD R RG Sbjct: 304 YREYRETSRERSRDR-RGRG 322 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 397 YPVYRQTKLKRSRDEL 444 Y YR+T +RSRD + Sbjct: 289 YRKYRETSKERSRDRI 304 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 337 RARYDCIVSSF*RRMVGCIPYPVYRQTKLKRSRD 438 R RY C + Y YR+T +RSRD Sbjct: 269 RKRYSCSREREQKSYKNENSYRKYRETSKERSRD 302 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,190 Number of Sequences: 438 Number of extensions: 4098 Number of successful extensions: 87 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -