BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20838 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_35532| Best HMM Match : Peptidase_S49 (HMM E-Value=2.7) 30 1.9 SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) 29 2.6 SB_49487| Best HMM Match : Zip (HMM E-Value=0.014) 29 3.4 SB_56545| Best HMM Match : Exonuc_X-T (HMM E-Value=1.2e-09) 29 3.4 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_1285| Best HMM Match : SET (HMM E-Value=0.011) 28 7.8 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 31.5 bits (68), Expect = 0.63 Identities = 23/84 (27%), Positives = 45/84 (53%) Frame = +1 Query: 31 RARRTRXSIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVK 210 R R+ + +KV E+ D + ++N EL +Q IK+ + L+ +KE+ + K Sbjct: 593 RDRQIQNLSLEKVNESRDDEITELEN-----ELEEQREIIKENEEKLKEKEKEIEKLKKK 647 Query: 211 VIVEEIKPSLKSDLETLKCRMKMR 282 +I E+ LK D+ET + +++ + Sbjct: 648 II--ELSDKLK-DMETSRNKVETK 668 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +3 Query: 315 PGPPQHQEHETQNPEHHEDAEKIVSSVKN---DINTAEIALRQGFQEVSDGIGKWYARTE 485 P PP H + E H E E+I S K+ D+ A+ L++ +++ + +G Y R Sbjct: 282 PNPPPHLDEEKIKQLHEELKEEIKSMAKDSEKDLEDAKKDLKEEIEQIKEEVG--YLRYM 339 Query: 486 QINEL 500 + +L Sbjct: 340 EAKQL 344 >SB_35532| Best HMM Match : Peptidase_S49 (HMM E-Value=2.7) Length = 149 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +1 Query: 46 RXSIPDKVPEAEDKPLNVVDNLSSEQELIDQ-ANTIKDIDNSLRANKKEVIDIPVKVIVE 222 + SIP P+ + K LN V+N++ +E ++ A+ + D+ N + + K E V V+ Sbjct: 72 KDSIPLAKPQKQQKVLNAVENINWPEEKKERFADVLNDVHN-ISSEKSEEEGDGVVFFVK 130 Query: 223 EIKPSLKSDLETLK 264 +K + +++L LK Sbjct: 131 SLKWA-RNELRILK 143 >SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) Length = 458 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 3/85 (3%) Frame = +1 Query: 34 ARRTRXSIPDKVPEAEDKPLNVVDNL--SSEQELIDQANTIKDIDNSLRANKKEVIDIPV 207 A R+R D +A L + + SS ++LID I+D ++S +KE + + Sbjct: 124 AMRSRGDTTDAEIKALKTQLKMAEETRDSSRRDLIDAHRKIRDAEDSKETLRKENLHVKR 183 Query: 208 KV-IVEEIKPSLKSDLETLKCRMKM 279 +V +E K SL+ + L+ ++K+ Sbjct: 184 QVKDLEMEKQSLEKSVSDLREKVKL 208 >SB_49487| Best HMM Match : Zip (HMM E-Value=0.014) Length = 510 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/67 (22%), Positives = 28/67 (41%) Frame = +3 Query: 261 EVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGF 440 +V ++ I+ LR+ H ++ + HH +KI S + + GF Sbjct: 49 DVSSGSDSIENEKFTLRDDHTDNHHQNHHDHHHHHHHDKKIDSKTSIATVAWMVIVSDGF 108 Query: 441 QEVSDGI 461 +SDG+ Sbjct: 109 HNLSDGL 115 >SB_56545| Best HMM Match : Exonuc_X-T (HMM E-Value=1.2e-09) Length = 416 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = +1 Query: 142 NTIKDIDNS--LRANKKEVIDIPVKVIVEEIKPSLKSDLETLKCRMKMRKSRGL*SI*EI 315 N +K + +S +++ K + D+PV +EE D ++ K RGL ++ + Sbjct: 315 NFMKQMKHSQEVKSRKDTLCDLPVSSSMEEKIAKSGMDFNKMRSVYKEGGERGLLTVLAL 374 Query: 316 PGPRS---IKSTKHRILNTTKMLKK 381 P S +K +K R+ T +++ K Sbjct: 375 PPQYSQLNVKGSKPRVTKTIRIINK 399 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = +3 Query: 258 VEVPDENEEIKRPLVDLRNPGPPQHQEHETQN---PEHHEDAEKI--VSSVKNDINTAEI 422 + PDE E + + DL NP + E E Q+ + +D EKI V S N + I Sbjct: 828 INSPDEREIVLSEIYDLDNPSDDEELETEIQDALETANEQDKEKILAVYSALRSPNLSGI 887 Query: 423 ALRQ 434 L Q Sbjct: 888 ELAQ 891 >SB_1285| Best HMM Match : SET (HMM E-Value=0.011) Length = 829 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 252 RNVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE-KIVSSVKNDI 407 + V + EE+ R LV L GPP + T+ P E ++S VK ++ Sbjct: 554 KKYSVAEFREELVRQLVGLEEFGPPPAHKPPTRAPNQFETVHMPMMSDVKRNL 606 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,709,031 Number of Sequences: 59808 Number of extensions: 335819 Number of successful extensions: 1207 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1086 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1202 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -