BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20834 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647,132... 33 0.17 05_06_0212 + 26410330-26410419,26410562-26410846,26411005-264112... 32 0.52 02_04_0223 + 21047240-21047304,21047577-21047706,21048783-210488... 32 0.52 05_01_0142 - 940421-940701,941262-941574 31 0.91 04_04_1148 + 31264847-31264870,31264987-31265062,31265226-31265887 30 1.6 01_07_0082 - 40965947-40967023 30 2.1 03_01_0289 + 2242584-2242931,2242973-2243005,2244158-2244241,224... 29 2.8 01_06_1682 - 39130696-39131705,39132355-39132583 29 2.8 08_02_0461 - 17432493-17432878,17434327-17434611,17435911-17436406 29 3.7 07_03_1067 + 23728642-23728690,23728832-23729010 29 3.7 03_05_0057 + 20350971-20351405 29 3.7 03_02_0996 - 13082540-13082818,13083107-13083221,13084135-130842... 29 3.7 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 4.8 02_05_1039 + 33707196-33708815 29 4.8 01_07_0046 - 40714701-40714763,40715266-40715343,40716398-407164... 29 4.8 01_02_0111 - 11220179-11220322,11220430-11220497,11220611-112206... 29 4.8 10_01_0270 - 2876907-2877547,2877838-2878012 28 6.4 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 28 6.4 06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622... 28 6.4 03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531,662... 28 6.4 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 28 6.4 01_06_1519 + 37942389-37943702,37944142-37944266,37944358-379444... 28 6.4 01_06_0293 - 28254673-28254878,28255189-28255306,28255767-282559... 28 6.4 04_01_0263 - 3532481-3532656,3532710-3532719,3532754-3532785,353... 28 8.5 03_06_0032 + 31182115-31182390,31182801-31183459,31183597-311837... 28 8.5 03_01_0474 + 3646724-3646789,3648952-3649067,3649547-3649595,364... 28 8.5 >03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647, 1327482-1327530,1328834-1328855,1328969-1329071 Length = 241 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 253 PPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 P YP PP SY PQ +Y PPQ Y Sbjct: 209 PQGGAYPPPGSYPPPGSYPPQGSYPPPQGYY 239 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 247 ADPPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 A PP YPQ PP SY P +Y PPQ +Y Sbjct: 202 AYPPAG-YPQGGAYPPPGSYPPPGSY-PPQGSY 232 >05_06_0212 + 26410330-26410419,26410562-26410846,26411005-26411208, 26411636-26411692,26411859-26412926 Length = 567 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 190 EPE-PAYPVETSKYVERSTQADPPINTYPQNNYAPPQNS 303 EPE P+Y VET + V T ADP + T P + +N+ Sbjct: 404 EPEVPSYQVETEEKVAELTVADPTVETMPLQDIHNEENA 442 >02_04_0223 + 21047240-21047304,21047577-21047706,21048783-21048871, 21049592-21049647,21049721-21049776,21050163-21050202, 21050505-21050629,21050715-21050808,21051401-21051480, 21051598-21051640,21057539-21057630,21057746-21057919 Length = 347 Score = 31.9 bits (69), Expect = 0.52 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +2 Query: 245 KPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPPG 358 KP+ R L+ +TPP+ ++ ++ + P+ PPG Sbjct: 296 KPLTRLPLVGPLLTPPVSVASVAKVAVRAATDPVFPPG 333 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.1 bits (67), Expect = 0.91 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 253 PPINTYPQNNYAPPQNSY-YPQNTYAPPQNTY 345 PP YP Y PP +Y P Y PP Y Sbjct: 30 PPHQGYPPQGYPPPPGAYPPPPGAYPPPPGAY 61 >04_04_1148 + 31264847-31264870,31264987-31265062,31265226-31265887 Length = 253 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 570 VYTVHYWADKTGYHAYGDHLPTPPPVPAAIQ 662 V+ +Y A+ T Y+A G + P PPP+PA ++ Sbjct: 196 VHLPYYAANATPYYA-GGYYPIPPPMPAMLR 225 >01_07_0082 - 40965947-40967023 Length = 358 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +1 Query: 184 TFEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 T+ P AYP T+ + S A P PQ+ Y PP P Y PP Sbjct: 175 TYPPPTAYP--TAAKADGSAAAAYP----PQSAYPPPGKGNEPSTAYPPP 218 >03_01_0289 + 2242584-2242931,2242973-2243005,2244158-2244241, 2244640-2245782 Length = 535 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +1 Query: 235 RSTQADPPINTYPQNNY--APPQNSYYPQNTYAPP 333 ++TQ+ PP + QN+ A P Y PQN+++ P Sbjct: 350 QTTQSQPPSSAVSQNSVTAARPLRGYSPQNSFSAP 384 >01_06_1682 - 39130696-39131705,39132355-39132583 Length = 412 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = +1 Query: 253 PPINTYP---QNNY-APPQNSYYPQNTYAPPQNTY 345 PP + YP Q++Y +PP Y P N+Y P +Y Sbjct: 222 PPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSY 256 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 11/68 (16%) Frame = +1 Query: 175 LVRTFEPEP--AYPVETSKYV---ERSTQADPPINTYPQNNYAPPQNSY------YPQNT 321 L F P P +P + +Y + S + PP P N+Y P SY Y N+ Sbjct: 208 LPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNS 267 Query: 322 YAPPQNTY 345 PP N Y Sbjct: 268 PIPPTNKY 275 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = +1 Query: 271 PQNNYAPPQ---NSYYPQNTYAPPQNTY 345 P N Y PP NS PQ ++PP N+Y Sbjct: 271 PTNKYLPPPYYFNSPPPQYQHSPPANSY 298 >08_02_0461 - 17432493-17432878,17434327-17434611,17435911-17436406 Length = 388 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAP 330 + P Y + Y+ PP TYP ++ PPQ YP Y P Sbjct: 204 YPPHQGY-TQAQSYLLLPEAYPPPPWTYPLSSAYPPQPVGYPSGGYPP 250 >07_03_1067 + 23728642-23728690,23728832-23729010 Length = 75 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 253 PPINTYPQNNYAPPQNSYYPQNTYAPPQ 336 PP YP Y PPQ Y P PPQ Sbjct: 35 PPAQGYPPAGY-PPQQGYPPPYAQPPPQ 61 >03_05_0057 + 20350971-20351405 Length = 144 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -3 Query: 564 HQLQCKSTSPFSPGLPLLYGIREVAFLAYVCSIGDLILVFVTAIITI 424 H +C S SP + L YG ++VAF Y + ++ +FV ++++ Sbjct: 87 HDPECCSRSPSAGPRMLSYGYKDVAFSPYSNYVRNMRKLFVVELLSM 133 >03_02_0996 - 13082540-13082818,13083107-13083221,13084135-13084235, 13084890-13085117,13085789-13086106,13086200-13086484, 13086566-13086913 Length = 557 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 630 PTPPPVPAAIQAALDQNAKEEAAQLKP 710 P PPP AA +AA ++ +EE + KP Sbjct: 21 PPPPPAVAAEKAAAEEEEEEEEEEKKP 47 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +3 Query: 255 ADKHLSPKQLRPPSKLILSSEYLCTSSK 338 +D LSP++ R PS L LSS YL S+K Sbjct: 1454 SDAALSPEESRKPSGLQLSSTYLQGSTK 1481 >02_05_1039 + 33707196-33708815 Length = 539 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 531 KKGWYSYTGADGKVYTVHYWADKTGY---HAYGDHLPTPPPVPAAIQAA 668 K+ + + +D V W D+ G+ + +G +PPPVPA ++ A Sbjct: 382 KELYLNLRSSDTWVAEYRRWMDRAGHGMPYYFGHSTLSPPPVPAVVEQA 430 >01_07_0046 - 40714701-40714763,40715266-40715343,40716398-40716462, 40717075-40717201,40717279-40717319,40717621-40717690, 40718070-40718191,40719047-40719107,40719182-40719292, 40719387-40719461,40719815-40719842,40719929-40719978, 40720228-40720290,40720385-40720426,40720562-40720631, 40720663-40720713,40721857-40722041,40722374-40722775 Length = 567 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 278 TITPPLKTHTILRIPMHLLKTPIVPP 355 T+ PP+KT T LR P + + PP Sbjct: 163 TVVPPIKTSTTLRTPSPIPPVAVEPP 188 >01_02_0111 - 11220179-11220322,11220430-11220497,11220611-11220644, 11220735-11220766,11220900-11220959,11221276-11221729 Length = 263 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 230 WNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPPGARLH 370 W A P P R L T P + +P L P PP +RLH Sbjct: 18 WGAAPSPAPRGELGTTGDTSPRAPTHVALLPRPLYTNPRQPPPSRLH 64 >10_01_0270 - 2876907-2877547,2877838-2878012 Length = 271 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSY-YPQNTYAPP 333 P P P K T PP+ +YP Y+ P Y P T +PP Sbjct: 173 PSPPAPAAYHKPPPSYTHPAPPVYSYPTPAYSHPTPVYKQPLPTPSPP 220 >06_03_1450 + 30246702-30247346,30248603-30248689,30248789-30248920, 30249016-30249162,30250375-30250440,30250519-30250629, 30251551-30251584,30251667-30251743,30251829-30251906 Length = 458 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 205 YPVETSKYVERSTQAD-PPINTYPQNNYAPPQNSYYPQNTYAPP 333 YP TS + A PP YP +YA P + YP TY PP Sbjct: 14 YPSPTSAPLATYPSASAPPYTPYPATDYAAP--AAYP--TYPPP 53 >06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448, 6222214-6222370,6224449-6224575,6224663-6224914 Length = 343 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNT--YAPPQNTYR 348 P PA+ + Y+ R T PP PQ ++ PP Y+P + + PP Y+ Sbjct: 138 PPPAF--QGPPYIARGTPP-PPAQMMPQPQHHGPPATIYHPSQSWYWYPPDYQYQ 189 >03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531, 6627009-6627116,6627194-6627328,6627429-6627528, 6627763-6627974,6628060-6628125,6628231-6628464, 6628583-6628641,6628716-6628782,6628863-6629192, 6629267-6629335,6629417-6629503,6629605-6629692, 6630057-6630178,6630251-6630355,6630442-6630485, 6630558-6630627,6630711-6630814,6630980-6631189, 6632935-6633018,6633291-6634003,6634115-6634649, 6634703-6634789,6634826-6634970,6635049-6635125, 6635215-6635359,6635462-6635626,6635725-6635958 Length = 1761 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 238 STQADPPINTYPQNNYAPPQNSYYPQNTYAPPQNT 342 ST + PP + P +PP S P APP N+ Sbjct: 1139 STSSSPPSSQSPPPGSSPPPASPPPSTPSAPPTNS 1173 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 594 DKTGYHAYGDHLPTPPPVPAAIQAALDQNAKEEAAQLK 707 D G+H D P PPP+ + ++ D +AK +K Sbjct: 173 DSHGWHPEADVPPPPPPLEPPVPSSSDYHAKPPLQAVK 210 >01_06_1519 + 37942389-37943702,37944142-37944266,37944358-37944499, 37944602-37944848,37946139-37946196,37947629-37947913, 37947988-37948120 Length = 767 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +3 Query: 624 HLPTPPPVP-AAIQAALDQ-NAKEEAAQLKPK 713 +LP PPP P A ++AA+++ A+E A+ +PK Sbjct: 110 NLPPPPPPPKAKVEAAVEETKAEETKAEEEPK 141 >01_06_0293 - 28254673-28254878,28255189-28255306,28255767-28255961, 28256701-28256800,28256887-28256972,28257078-28257239, 28257965-28258101,28258233-28258281,28258688-28258746, 28258862-28258896,28259384-28259433,28260173-28260332, 28260898-28260963,28261065-28261162,28261649-28261696, 28262114-28262242,28262667-28262769,28262858-28262954, 28263181-28263241,28263659-28263740,28263845-28263962, 28264039-28266325 Length = 1481 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 243 PSRSADKHLSPKQLR-PPSKLILSSEYLCTSSKHLSSHLEHAFISDF 380 PS SA LSP PP+ LI S +L + +H F+S F Sbjct: 36 PSASAASPLSPVPASVPPTALIPGSRFLVDAFRHAGDFTASYFLSHF 82 >04_01_0263 - 3532481-3532656,3532710-3532719,3532754-3532785, 3533237-3533348,3533586-3533649,3533778-3533843, 3533946-3534073,3534205-3534342,3534427-3534539, 3534611-3534776,3535045-3535107,3535197-3535304, 3535408-3535524,3535620-3535785,3535942-3536039, 3536136-3536233,3536378-3536514,3536654-3536878, 3536971-3537176,3537286-3537525 Length = 820 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 621 DHLPTPPPVPAAIQAALDQNAKEEAAQLKP 710 D LP PPPVPA + + + E KP Sbjct: 9 DELPPPPPVPANVVPIKADDVESEVPANKP 38 >03_06_0032 + 31182115-31182390,31182801-31183459,31183597-31183740, 31184025-31184061 Length = 371 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = +1 Query: 229 VERSTQADPP-INTYPQ---NNYAPPQNSYYPQNTYAPP 333 VE A PP I+ PQ NYAPP + +P +PP Sbjct: 73 VEEDVAAAPPGISLAPQFSMANYAPPPSYQHPATLVSPP 111 >03_01_0474 + 3646724-3646789,3648952-3649067,3649547-3649595, 3649641-3649697,3649743-3650993 Length = 512 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = -3 Query: 648 VREEEWVNGPRKHGSQSCRPSSGRCKLCHQLQCKSTSPFSPGLP 517 V ++V G + +P+ + + H+ +C++ +P PGLP Sbjct: 114 VSARKFVPGAKLCMQPDIKPNKRKSRSSHKERCRTQAPLLPGLP 157 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,700,747 Number of Sequences: 37544 Number of extensions: 468114 Number of successful extensions: 2072 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2044 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -