BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20834 (713 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59170.1 68418.m07416 proline-rich family protein contains pr... 40 0.002 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 38 0.007 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 33 0.14 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 33 0.14 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 33 0.19 At2g27090.1 68415.m03255 expressed protein contains Pfam domains... 32 0.43 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 32 0.43 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 0.76 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 0.76 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 1.0 At5g10730.1 68418.m01243 expressed protein 31 1.0 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 31 1.0 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 1.0 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 29 2.3 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 29 3.1 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 29 3.1 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 4.0 At5g15140.1 68418.m01774 aldose 1-epimerase family protein simil... 28 7.1 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 28 7.1 At1g09070.1 68414.m01012 C2 domain-containing protein / src2-lik... 28 7.1 At5g63530.1 68418.m07974 copper chaperone (CCH)-related low simi... 27 9.3 At4g34440.1 68417.m04894 protein kinase family protein contains ... 27 9.3 At4g28030.1 68417.m04021 GCN5-related N-acetyltransferase (GNAT)... 27 9.3 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 27 9.3 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 27 9.3 At3g05545.1 68416.m00609 transcription factor, putative / zinc f... 27 9.3 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 27 9.3 At2g39850.1 68415.m04894 subtilase family protein contains simil... 27 9.3 At1g67140.1 68414.m07638 expressed protein 27 9.3 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 27 9.3 At1g01510.1 68414.m00067 C-terminal binding protein (ANGUSTIFOLI... 27 9.3 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 345 ++ + P YP KY + Q PPI YP Y PP Y P Y PP Y Sbjct: 150 IKKYPPPEHYPPPIKKYPPQE-QYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKY 205 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 345 + P YP KY Q PPI YP Y+PP Y P Y PP Y Sbjct: 101 YPPPEQYPPPIKKYPPPE-QYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKY 153 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 345 ++ + P Y KY Q PPI YP +Y PP Y PQ Y PP Y Sbjct: 124 IKKYPPPEQYSPPFKKYPPPE-QYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKY 179 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +1 Query: 181 RTFEPEPAYPVETSKYVERSTQADPPINTYP-QNNYAPPQNSYYPQNTYAPPQNTY 345 + + P YP KY PPI YP Q Y PP Y P Y PP Y Sbjct: 138 KKYPPPEQYPPPIKKYPPPE-HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKY 192 Score = 37.1 bits (82), Expect = 0.012 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 345 ++ + P YP KY Q PP YP Y PP Y P Y PP Y Sbjct: 111 IKKYPPPEQYPPPIKKYPPPE-QYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKY 166 Score = 35.9 bits (79), Expect = 0.027 Identities = 20/56 (35%), Positives = 23/56 (41%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 ++ + P YP KY Q PPI YP PP Y P Y PP TY Sbjct: 176 IKKYPPPEKYPPPIKKYPPPE-QYPPPIKKYP-----PPIKKYPPPEEYPPPIKTY 225 Score = 35.5 bits (78), Expect = 0.035 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 345 P YP KY Q PPI YP Y PP Y P Y+PP Y Sbjct: 90 PIKTYPHPPVKYPPPE-QYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKY 140 Score = 34.7 bits (76), Expect = 0.062 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +1 Query: 193 PEPAYPVETSKYVER-STQADPPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 P P Y KY T PP+ P Y PP Y P Y PP Y Sbjct: 76 PPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKY 127 Score = 33.9 bits (74), Expect = 0.11 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKYVERSTQADPPINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 345 ++ + P+ YP KY + PPI YP Y PP Y P PP Y Sbjct: 163 IKKYPPQEQYPPPIKKYPPPE-KYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEY 218 Score = 32.3 bits (70), Expect = 0.33 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +1 Query: 193 PEPAYPVETSKYVER--STQADPPINTYPQNNYAPPQNSYY---PQNTYAPP 333 P YP KY T PPI TYP PP +Y P+ Y PP Sbjct: 221 PIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPP 272 Score = 31.1 bits (67), Expect = 0.76 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 11/64 (17%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKY---VER---STQADPPINTYPQN--NYAPPQNSYYPQ---NTY 324 ++ + P YP KY +++ + PPI TYP Y PP YP TY Sbjct: 189 IKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTY 248 Query: 325 APPQ 336 PP+ Sbjct: 249 PPPK 252 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/56 (26%), Positives = 18/56 (32%) Frame = +1 Query: 178 VRTFEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 + + P YP KY + P P Y P Y P Y PP Y Sbjct: 59 IEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKY 114 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 37.9 bits (84), Expect = 0.007 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPI-NTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 + P YP + S Y ST PPI + YP PP +S YP Y PPQ +Y Sbjct: 184 YPPASGYPPQPSAYPPPSTSGYPPIPSAYP----PPPPSSAYPPQPY-PPQPSY 232 Score = 37.5 bits (83), Expect = 0.009 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = +1 Query: 187 FEPEP-AYPV-ETSKY--VERSTQADPPINTYPQNNYAPPQNSYYPQNTY 324 + P+P AYP TS Y + + PP + YP Y PPQ SYYPQ Y Sbjct: 190 YPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPY-PPQPSYYPQGPY 238 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 253 PPINTYPQNNYAPPQNSYYPQNTYAPPQNT 342 P + YPQ + PP + Y PQ + PP +T Sbjct: 173 PQVQQYPQPSGYPPASGYPPQPSAYPPPST 202 >At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 199 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSY--YPQNTYAPP 333 + P+ YP S Y + Q PP + YPQN PP ++Y YP Y PP Sbjct: 150 YPPQQGYP--PSGYPQHPPQGYPP-SGYPQN---PPPSAYSQYPPGAYPPP 194 Score = 30.3 bits (65), Expect = 1.3 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTY-PQNNYAPPQNSYYPQNTYAP---PQN 339 F P+P V ++ + R QA PP Y PQ Y P +P Y P PQN Sbjct: 124 FGPQPM-AVPPAQQMSRFDQATPPAVGYPPQQGYPPSGYPQHPPQGYPPSGYPQN 177 >At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 255 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSY--YPQNTYAPP 333 + P+ YP S Y + Q PP + YPQN PP ++Y YP Y PP Sbjct: 206 YPPQQGYP--PSGYPQHPPQGYPP-SGYPQN---PPPSAYSQYPPGAYPPP 250 Score = 30.3 bits (65), Expect = 1.3 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTY-PQNNYAPPQNSYYPQNTYAP---PQN 339 F P+P V ++ + R QA PP Y PQ Y P +P Y P PQN Sbjct: 180 FGPQPM-AVPPAQQMSRFDQATPPAVGYPPQQGYPPSGYPQHPPQGYPPSGYPQN 233 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.1 bits (72), Expect = 0.19 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 184 TFEPEPAYPVETSKYVERSTQADPPINT--YPQ--NNYAPPQNSYYPQNTYAPP 333 T P P PV Y TQ+ PP + YP N+ PP YYP TY+PP Sbjct: 549 TQSPPPPSPV----YYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPP 598 Score = 32.3 bits (70), Expect = 0.33 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 184 TFEPEPAYPVETSKYVERSTQADPPINT--YPQNNYAPPQNS--YYPQNTYAPP 333 T P P PV Y T + PP + YP Y+PP S YYPQ T +PP Sbjct: 564 TQSPPPPSPV----YYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPP 613 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +1 Query: 199 PAYPVETSKYVERSTQADPPINT--YPQNNYAPPQNS--YYPQNTYAPPQNT 342 P+ P + Y T + PP + YP +PP S YYP T +PP T Sbjct: 625 PSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPT 676 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +1 Query: 172 QLVRTFEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYY 309 Q ++EP P Y +S T PP+ + + PP SYY Sbjct: 699 QATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPPPSYY 744 Score = 27.9 bits (59), Expect = 7.1 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +1 Query: 184 TFEPEPAYPVETSKYVERSTQADPPINT--YPQNNYAPPQNS--YYPQNTYAPP 333 T P P PV Y T + PP + YPQ +PP S YYP T +PP Sbjct: 579 TNSPPPPSPV----YYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPP 628 >At2g27090.1 68415.m03255 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 743 Score = 31.9 bits (69), Expect = 0.43 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +1 Query: 196 EPAYPVETSKYVERSTQADPPINTYPQN----NYAPPQNSYYPQNTYAPP 333 E PVE+S Y S + P+ ++ +Y+PP S+ +TY+PP Sbjct: 57 ETEVPVESSLYTSTSATPEQPLALIEKSVSHLSYSPPPASHSHHDTYSPP 106 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.9 bits (69), Expect = 0.43 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 247 ADPPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 A PP YP Y PP + YP Y PP Y Sbjct: 36 AYPPPGGYPPQGYPPPPHG-YPPAAYPPPPGAY 67 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.1 bits (67), Expect = 0.76 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P P Y + + PP YP Y+PP YP Y+PP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPP 102 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.1 bits (67), Expect = 0.76 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PPIQ P +++ P KP T +PP+K + + P PI PP Sbjct: 136 PPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 31.1 bits (67), Expect = 0.76 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+Q P ++ P KP T +PP+K+ + + P PI PP Sbjct: 271 PPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPP 322 Score = 31.1 bits (67), Expect = 0.76 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +2 Query: 200 PPIQWKPQNTWNAP--PKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+Q P T++ P P P++ T I +PP+K + + P + P+ PP Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPI---YSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 31.1 bits (67), Expect = 0.76 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPPGARL 367 PP+ P T++ P KP T +PP+K + + P P+ PP +L Sbjct: 624 PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQL 679 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 200 PPIQWKPQNTWNAP--PKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PPIQ P T++ P P PI++ T +PP+ I + P PI PP Sbjct: 85 PPIQKPPTPTYSPPIYPPPIQKPPT--PTYSPPIYPPPIQKPPTPTYSPPIYPP 136 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PPI P T++ P KP T +PP+K + + P PI PP Sbjct: 556 PPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 607 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P T++ P KP T +PP+K + + P PI PP Sbjct: 539 PPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 590 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P T++ P KP T +PP+K + + P PI PP Sbjct: 573 PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 624 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P T++ P KP T +PP+K + + P PI PP Sbjct: 590 PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 641 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P T++ P KP P +PP+K + + P + PI PP Sbjct: 170 PPVHKPPTPTYSPPIKPPVHKPPTP-IYSPPIKPPPVHKPPTPIYSPPIKPP 220 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPK--PIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+Q P T++ P K P++ T I +PP+K + + P + P+ PP Sbjct: 406 PPLQKPPTPTYSPPIKLPPVKPPTPI---YSPPVKPPPVHKPPTPIYSPPVKPP 456 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P T++ P KP +PP+K + + P + P+ PP Sbjct: 220 PPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P ++ P KP T +PP+K + + P + PI PP Sbjct: 203 PPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPK--PIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP+ P T++ P K P+++ T +PP+K + + P PI PP Sbjct: 288 PPVHKPPTPTYSPPVKSPPVQKPPT--PTYSPPIKPPPVQKPPTPTYSPPIKPP 339 Score = 27.5 bits (58), Expect = 9.3 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +2 Query: 200 PPIQWKPQNTWNAPPKPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 PP++ P T++ P KP T +PP+K I + P PI PP Sbjct: 523 PPVK-PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPP 573 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +1 Query: 199 PAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P P+ + ST A PP+ T P APP + P +PP Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPP 49 >At5g10730.1 68418.m01243 expressed protein Length = 287 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +2 Query: 245 KPIRR*TLIPKTITPPLKTHTILRIPMHLLKTPIVPPG 358 KP+ + L+ TPP+ ++ ++ + P+ PPG Sbjct: 234 KPLNQLPLVGPLFTPPVNVESVAKVAVRAATDPVFPPG 271 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P PA PV T R Q P ++ P + PP ++ +P Y PP Sbjct: 63 PPPAPPVGTM----RPGQPSPFVSQIPGSRPPPPSSNSFPSPAYGPP 105 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +1 Query: 181 RTFEPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 345 +T P YP + Y + ++ PP Q+ PP +YY + PP Y Sbjct: 585 QTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVY 639 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +1 Query: 199 PAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P PV S V +S PP+ P PP YYP T +PP Sbjct: 662 PPPPVYYSP-VTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPP 705 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 208 PVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P + Y +S PP Y + PP YYP T +PP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPP 648 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 250 DPPINTYPQNNYAPPQNSYYPQNTYAPP 333 D P N YP + PP S YP N + PP Sbjct: 221 DNPTNDYPA-DVPPPPPSSYPSNDHLPP 247 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P+P P + S +R + P+N+ P Y+PP P ++PP Sbjct: 501 PQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPP---PPPVHSPP 544 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +1 Query: 193 PEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTYAPP 333 P P PV + S PP+ + P ++PP S P Y+PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP-SQSPPVVYSPP 641 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 603 GYHAYGDHLPTPPPVPAAIQAALDQNAKE 689 GYHA +PTPPP+ A QN K+ Sbjct: 200 GYHAPPVPMPTPPPIAAPSSYVPVQNIKD 228 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +1 Query: 247 ADPPINTYPQNNYAPPQNSY----YPQNTYAPPQNTY 345 A PP YPQ Y PP +Y YP Y P Y Sbjct: 26 AYPPAG-YPQQGYPPPPGAYPPAGYPPGAYPPAPGGY 61 >At5g15140.1 68418.m01774 aldose 1-epimerase family protein similar to SP|P05149 Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase) from Acinetobacter calcoaceticus; contains Pfam profile PF01263 Aldose 1-epimerase Length = 490 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 29 LILIVAAFLAVTFADNVE-SDKEIEDSEAAESV 124 L++ + ++VTFADNVE K++E S+ + V Sbjct: 12 LLVTLGVVISVTFADNVELKSKDLESSKKDKKV 44 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 27.9 bits (59), Expect = 7.1 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 212 WKPQNTWNAPPKPIRR*-TLIPKTITPPLKTHTILRIPMHLLKTPIVPP 355 +KP PP PI + +IPK PP I + P+ + K P+V P Sbjct: 209 YKPPVPIYKPPVPIYKPPVVIPKKPCPPKIHKPIYKPPVPIYKPPVVIP 257 >At1g09070.1 68414.m01012 C2 domain-containing protein / src2-like protein, putative similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain; identical to cDNA src2-like protein GI:3426059 Length = 324 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 187 FEPEPAYPVETSKYVERSTQADPPINTYP-QNNYAPPQNSYYPQNTYAPPQ 336 + P AYP + Y Q YP Q Y PQ Y PQ Y PQ Sbjct: 215 YPPPGAYP-QQGGYPGYPPQQQGGYPGYPPQGPYGYPQQGYPPQGPYGYPQ 264 >At5g63530.1 68418.m07974 copper chaperone (CCH)-related low similarity to copper homeostasis factor [GI:3168840]; nearly identical to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 355 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 579 VHYWADKTGYHAYGDHL-PTPPPVPAAIQAALDQNAKEE 692 V Y +TG HA + P PPP P AA + KEE Sbjct: 222 VEYVYKRTGKHAAIMKIDPPPPPPPEEAAAAAEGEKKEE 260 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +1 Query: 208 PVETSKYVERSTQADPPINTYPQNNYAP--PQNSYYPQNTYAPP 333 PV++S E S P T P N +P P +S P + APP Sbjct: 5 PVDSSPAPETSNGTPPSNGTSPSNESSPPTPPSSPPPSSISAPP 48 >At4g28030.1 68417.m04021 GCN5-related N-acetyltransferase (GNAT) family protein contains Pfam profile PF00583: acetyltransferase, GNAT family Length = 274 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 620 PVSMVASLVGPVVDGVNFAISSSVRVPALFHQACL 516 PV+ + + P +D F IS SV L+ ACL Sbjct: 41 PVAASSHICAPAIDKSTFVISESVSEDELWAAACL 75 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = +1 Query: 190 EPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSYYPQNTY 324 +P P P + Q PP+ YP + PP YP Y Sbjct: 27 QPPPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYPNYPNAPY 71 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 27.5 bits (58), Expect = 9.3 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = +1 Query: 187 FEPEPA-YPVETSKYVERSTQADPPINTYPQN-NYAPPQ--NSYYPQNTYAPPQNTY 345 + P PA P + Y PP YP + PPQ +YY + + PP + Y Sbjct: 62 YSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSKY 118 >At3g05545.1 68416.m00609 transcription factor, putative / zinc finger (C3HC4 type RING finger) family protein similar to VIP2 protein [Avena fatua] gi|6996144|emb|CAB75506; contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 425 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 516 EASLVKKGWYSYTGADGKVYTVHYWADKTGYHAYGDHLPTPPP 644 ++S W + + G+V T + + YH + H P PPP Sbjct: 195 DSSSFSSHWNTGSSVSGEVPTPYGFPVDPHYHGWDYHPPPPPP 237 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 190 EPEPAYPVETSKYVERSTQADPPINTYPQNNYAPPQNSY 306 EPEPA+ + + + D PI T +N PP N++ Sbjct: 124 EPEPAFTEQDNTVINFDAYEDIPIET-SGDNVPPPVNTF 161 >At2g39850.1 68415.m04894 subtilase family protein contains similarity to subtilisin-like protease C1 GI:13325079 from [Glycine max] Length = 774 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 250 DPPINTYPQNNYAPPQNSYYP-QNTYAPPQNT 342 D PI Y N Q+S+YP N APP++T Sbjct: 346 DKPIIVYDTINTFETQDSFYPLLNEKAPPEST 377 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 27.5 bits (58), Expect = 9.3 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 605 ASLVGPVVDGVNFAISSSVRVPALFHQACLFCMG 504 AS P DG NFA S + A+F ACL +G Sbjct: 1627 ASSQKPYTDGTNFAADSGFHLRAIF-GACLHMVG 1659 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 585 YWADKTGYHAYGDHLPTPPPVPAAIQAALDQNAKEEAAQ 701 Y++ G H Y P PPP A I A Q E +Q Sbjct: 157 YYSAPQGNHYYSPSPPPPPPPQAPITAPSPQRDYREFSQ 195 >At1g01510.1 68414.m00067 C-terminal binding protein (ANGUSTIFOLIA) nearly identical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Length = 636 Score = 27.5 bits (58), Expect = 9.3 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 14 DIKMKLILIVAAF-LAVTFADNVESDKEIEDSEAAE 118 +I+ K I I+ +F L N SD+E+E+SEA+E Sbjct: 318 EIREKAISILHSFFLDGVIPSNTVSDEEVEESEASE 353 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,198,175 Number of Sequences: 28952 Number of extensions: 350584 Number of successful extensions: 1410 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1355 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -