BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20833 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 4e-21 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 26 0.65 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 30 1.9 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 29 2.6 SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 28 5.9 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 28 5.9 SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_36342| Best HMM Match : Viral_helicase1 (HMM E-Value=1.1) 28 7.8 SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 25 8.6 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect = 4e-21 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +1 Query: 43 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 222 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect = 1e-12 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 321 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 500 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 501 VK 506 VK Sbjct: 703 VK 704 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 26.2 bits (55), Expect(2) = 0.65 Identities = 13/54 (24%), Positives = 27/54 (50%) Frame = +2 Query: 107 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKV*RY 268 +PC ++ C + +S+ V ++K P P TL ++G + +K+ +Y Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVKY 451 Score = 23.8 bits (49), Expect(2) = 0.65 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 89 PGPQPPSPCNVRP 127 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 56 TSKTHTLRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 190 T+K HT +P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 8 HISFLTVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRPC 130 H L K KT + T+K +T +P T P+ P +PC Sbjct: 92 HTIKLYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +2 Query: 44 QQWVTSKTHTLRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 199 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 133 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNGKSMKISVPPH 282 + G +M +G+PCKI + K G HG +H+ G D NG +S PH Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG---CVSAGPH 62 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -3 Query: 523 VESCVALTAMTHSS----PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIR 356 V C L A++ S P+ S V + +LP+ V C+P SPS I RS P Sbjct: 235 VVECGGLRAISECSDPYPPRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISN 293 Query: 355 VR 350 VR Sbjct: 294 VR 295 >SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = -1 Query: 300 GVRPCCVWRDRYLHTFTIEDINPNQVNFSVAVLSGFGCGHFNNLAWTTLQHNETVFTQ 127 G+R C D L F + + + S A ++ +G GH N + L H + TQ Sbjct: 243 GLRSCITHGDDLLSVFDNMESSSKVFDMSNAPVTRYGLGHVNQILEEELSHLRFLKTQ 300 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -3 Query: 145 RNRFYAGPNIAW--GRWLRPRSLRSQSV 68 R F+ PN+A G+WL P+SLR+ V Sbjct: 947 REGFFNNPNLAGCKGQWLGPKSLRASRV 974 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 23 TVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRP 127 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 27.9 bits (59), Expect = 7.8 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = +3 Query: 288 MDVPHVKREDYQLTDISDDGYLT----LMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 455 +D+P+ K + + L ++DD L+ + D L E L PD + R D G E Sbjct: 37 LDIPYEKYDKFDLESLTDDECLSEFRFIKNDLYRLNEALNFPD-QITCPNRLTVD-GMEA 94 Query: 456 LCTVLKSCGEEC 491 LC L+ C Sbjct: 95 LCMTLRRFAYPC 106 >SB_36342| Best HMM Match : Viral_helicase1 (HMM E-Value=1.1) Length = 872 Score = 27.9 bits (59), Expect = 7.8 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = +3 Query: 264 DICPSTHNMDVPHVKREDYQLTDISDDGYLTLM----ADNGDLREDLKIPDGDLGTQLRT 431 D+ S H +D+P+ E++ + +D ++ +D L E L+IPD T + Sbjct: 592 DLNTSNH-IDLPYNSYENFDFDILEEDECMSEFRFHKSDIPLLAEMLQIPDRL--TLYQR 648 Query: 432 DFDSGKELLCTVLKSCGEECVIAVKATQLSTNKP 533 SG E LC VLK C A + S P Sbjct: 649 SVCSGLEALCIVLKRLAYPCRYADMVAKFSRPVP 682 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 25.0 bits (52), Expect(2) = 8.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 62 KTHTLRPETPGPQPPSP 112 K H +P P P PPSP Sbjct: 344 KEHPDKPRDPAPVPPSP 360 Score = 21.0 bits (42), Expect(2) = 8.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 86 TPGPQPPSPCNVRPCVKT 139 T GP PP+ N +P T Sbjct: 377 TFGPPPPAASNAKPAQYT 394 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,106,582 Number of Sequences: 59808 Number of extensions: 494579 Number of successful extensions: 1464 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1454 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -