BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20825 (709 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045642-4|AAK67210.1| 226|Caenorhabditis elegans Vacuolar h at... 79 4e-15 >AF045642-4|AAK67210.1| 226|Caenorhabditis elegans Vacuolar h atpase protein 8 protein. Length = 226 Score = 78.6 bits (185), Expect = 4e-15 Identities = 34/56 (60%), Positives = 46/56 (82%) Frame = +2 Query: 542 VDTENFLSPDTCGGIELVAARGRIKISNTLESRLELIAQQLLPEIRNALFGRNPNR 709 +D +NFL ++ GG+EL A G+IK+S+TLESRLELIA Q++P++R ALFG NPNR Sbjct: 167 LDKQNFLPSESAGGVELSARAGKIKVSSTLESRLELIANQIVPQVRTALFGPNPNR 222 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/78 (48%), Positives = 49/78 (62%) Frame = +3 Query: 255 QSSNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEP 434 Q+SN LN RL+ LK REDH+ VLDEAR L+ + D Y +L L++Q L QL+E Sbjct: 71 QASNSLNAGRLRCLKAREDHIGAVLDEARSNLSRISGDAARYPAILKGLVMQGLLQLLEK 130 Query: 435 TVTIRVRQTDKALVESLL 488 V +R R+ D LVE LL Sbjct: 131 EVVLRCREKDLRLVEQLL 148 Score = 61.3 bits (142), Expect = 7e-10 Identities = 31/52 (59%), Positives = 34/52 (65%) Frame = +1 Query: 52 LSDADVQKQIKHMMAFIEQXXXXXXXXXXXXXXXXFNIEKGRLVQQQRLKIM 207 +SD DVQKQ++HMMAFIEQ FNIEKGRLVQQQR KIM Sbjct: 3 ISDNDVQKQLRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRQKIM 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,196,765 Number of Sequences: 27780 Number of extensions: 273759 Number of successful extensions: 797 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -