BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20823 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 29 0.13 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.2 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 2.9 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.6 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 8.8 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.13 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +1 Query: 88 DGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWCESRR 210 D A QH+ RP+RS + NP GR H C+SRR Sbjct: 273 DENPAGAQQHLSHRPQRSTRKNP------AGRQHDRCDSRR 307 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 374 SIKLIKKPFSLFSHWSGFVMNTKSFSSSSKNIEMAVDL 261 +++L+KKP SL S W + N ++A+ L Sbjct: 156 TVRLLKKPPSLDSEWKSSTSTIQLIEQLDSNKQLAIAL 193 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 167 LVSKAGIIAGARAGETRFTDTRKDEQDRCTPLNLRPSL 280 +V + G++ G ET RK+ +R PL R L Sbjct: 804 MVLQEGVVEGGTKDETDMERERKEMVERSRPLRKRKRL 841 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 103 EYPQHVCDRPRRSRQVNPHGLVGFQG 180 ++P HVC+R R+ +N +V G Sbjct: 350 QHPLHVCERFERASVINREEIVRKHG 375 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 8.8 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 491 STVSVCTHTPDVRSTTTRAPSVTRSAAVTSEEKST-CPGES 372 +TV+ T T +TTT AP+ T + A +T PG++ Sbjct: 34 TTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQT 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,358 Number of Sequences: 2352 Number of extensions: 13903 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -