BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20819 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 25 1.7 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 23 6.8 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 194 VWRILAKLLLSLPCIDIMIAGT 129 +WR +LLLSL C+ +I+ T Sbjct: 1 MWRCKVRLLLSLLCLTFLISTT 22 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 420 AISLLLPVMEDLQTTPKQHQHVYPNQGAHGIWT 322 A+S L +E+L +T K+H P + A +WT Sbjct: 190 ALSPDLNPIENLWSTLKRHVKNQPARSADDLWT 222 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,864 Number of Sequences: 2352 Number of extensions: 17412 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -