BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20814 (688 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 3.1 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 3.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 4.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 4.1 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 4.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.1 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 5.4 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 7.2 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.5 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 222 NPYYNPRAVGGEWPR 266 NPYY PR E PR Sbjct: 230 NPYYRPRTSRTEPPR 244 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 82 TFIMIY*FVFVLTLF*YPLDVKGC*VV 2 TF +I+ VFV TL L + GC VV Sbjct: 209 TFAIIHLSVFVYTLVSVILIIMGCDVV 235 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 210 SRYYNPYYNPRAVGGEWPRSCTASPKPHRRLQ 305 S Y Y+P V ++P+ A+P P LQ Sbjct: 36 STYPPACYSPPQVAPQYPQHPYAAPAPGHGLQ 67 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 346 CRYQLRTATRKRSLLPSATREPDLQPHSSDRTG 444 C+Y R T+ +LL D +P+S D G Sbjct: 82 CKYCNRQFTKSYNLLIHERTHTDERPYSCDICG 114 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 129 YTYNPYYGNVDSLS 170 Y PYY N+D LS Sbjct: 253 YNNYPYYSNMDYLS 266 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +3 Query: 81 VMYAFVMMSCALLVQAYTY 137 + YAF SC +++Q+ ++ Sbjct: 144 ICYAFGKFSCKVMIQSVSF 162 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +3 Query: 81 VMYAFVMMSCALLVQAYTY 137 + YAF SC +++Q+ ++ Sbjct: 377 ICYAFGKFSCKVMIQSVSF 395 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +3 Query: 81 VMYAFVMMSCALLVQAYTY 137 + YAF SC +++Q+ ++ Sbjct: 377 ICYAFGKFSCKVMIQSVSF 395 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,989 Number of Sequences: 336 Number of extensions: 3492 Number of successful extensions: 20 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -