BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20813 (680 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 23 3.1 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 4.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.0 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 76 ITSRHVLTAAHCMHNHDDDLYLVRVGEL 159 I+ +H T + MH + +LVR ++ Sbjct: 83 ISDKHGFTILNSMHKYQPRFHLVRANDI 110 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 518 GYKKGGKDACQGDSGG 565 G + GG+D +GD GG Sbjct: 93 GGRGGGRDGDRGDGGG 108 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +1 Query: 16 NLGYKPRRGGGVRWLCGGSLITSRHVLTAAHC 111 N G P W C +++TS ++ A C Sbjct: 1028 NAGTTPGAILAFSWACNDAVMTSDSIMKCAFC 1059 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,498 Number of Sequences: 336 Number of extensions: 2822 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -