BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20810 (768 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.0 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 22 4.7 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 6.2 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 6.2 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 8.2 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 708 PFVCEDSDELLNFVRSRNR 764 P+V S ELL+F++S NR Sbjct: 694 PYVGVHSSELLDFLKSGNR 712 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 589 QAQLITEKLLKVTTSPVWRYLTTSIMMALNGT 684 Q + TE LLK +S + T I+ ++GT Sbjct: 83 QGLVSTEMLLKKDSSEAFNEFRTKILAQVHGT 114 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 474 RSQPAKLHLRPEVQM*RMFPRAILCFTNSFS 382 R KLHL+ ++ P +LC+ S+S Sbjct: 502 RKPTKKLHLKNSPISKKVRPPQVLCYITSWS 532 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 586 RSHRCKTNRPCYVGWWARSWLPNLTRPTVH 497 R RC +RP + AR P PT H Sbjct: 181 REERCDPDRPLPLDQKARDLSPRNGSPTDH 210 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -1 Query: 636 RTRRYLEQLLCYQLRL 589 ++ +YL+Q++C LRL Sbjct: 326 QSMKYLDQVVCESLRL 341 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,213 Number of Sequences: 336 Number of extensions: 4308 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -