BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20810 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0100 + 13389899-13390219,13390723-13390841,13391220-133913... 29 3.1 08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 29 4.1 09_04_0532 + 18386593-18386722,18386826-18386900,18387098-183875... 28 9.4 >07_03_0100 + 13389899-13390219,13390723-13390841,13391220-13391315, 13391481-13391553,13392055-13392123 Length = 225 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 546 GGGPDLGSRT*PDQPFTFGGCRSPRSQP--AKLHLRPEVQM*RMFPRAILCF 397 GG P L R+ P++P F RSP ++ ++ R M M P C+ Sbjct: 70 GGSPSLTRRSSPEKPGPFSQTRSPETEKMNKRVERRKRKYMVMMLPSTCCCW 121 >08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 Length = 359 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 151 NCCRQAKVPAHLCSVDEDCETRMRVLAENGYG 56 +CC Q KV L S +ED E +R + +GYG Sbjct: 5 SCCNQQKVKRGLWSPEED-EKLIRYITTHGYG 35 >09_04_0532 + 18386593-18386722,18386826-18386900,18387098-18387510, 18387682-18387688,18387944-18388005,18388046-18388341, 18388456-18388813,18388916-18389491,18389956-18390231 Length = 730 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 7 LHSRSLRTDYIKAARARRSRSPQVRASVFHSLHQHYR 117 L S+S+ Y K+ +ARR +P+ R + S+ H R Sbjct: 502 LESQSMIDYYFKSGQARRDENPKFRNPKYLSMLNHLR 538 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,843,871 Number of Sequences: 37544 Number of extensions: 558514 Number of successful extensions: 1621 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1621 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -