BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20809 (764 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 25 1.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.9 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 5.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.9 AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 23 7.8 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 25.4 bits (53), Expect = 1.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +3 Query: 69 IQQHSNRNKSSAPSEFNSKCRHCRRCASNGGRAVTKI 179 +Q H N + + P +C+HC C + G + I Sbjct: 170 LQNHVNTHTGTKPH----RCKHCDNCFTTSGELIRHI 202 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 350 VAIVINMIPSQFRDYITNLSS*VLGKIHLKGENNCSLS 237 +A+V+ P +F DY+ + +L G+ NC++S Sbjct: 1169 IAVVVLKTPVRFNDYVQPICLPARDAPYLPGQ-NCTIS 1205 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -2 Query: 433 ILIPASLMFGSCALAQVNM 377 + +P +L+FGS L Q+N+ Sbjct: 341 VSLPGTLLFGSANLTQLNL 359 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 350 VAIVINMIPSQFRDYITNLSS*VLGKIHLKGENNCSLS 237 +A+V+ P +F DY+ + +L G+ NC++S Sbjct: 1169 IAVVVLKTPVRFNDYVQPICLPARDAPYLPGQ-NCTIS 1205 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 590 EPIIQKHFSDVLLPLMQVIVLSIEA 664 +PII K D+LL +MQ I + A Sbjct: 235 KPIIAKTIEDILLAIMQNIFHQLPA 259 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,897 Number of Sequences: 2352 Number of extensions: 15637 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -