BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20806 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 2.0 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 6.1 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 8.1 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -3 Query: 317 GLFGHSSLNKTVIPLNIILYISWHRDISEFKFSTEIVENTICSHDKD 177 GLFG SL+ ILY I+EF STE++++ D Sbjct: 238 GLFG-LSLSALQTDGYKILYFHAMSSIAEFSVSTEVLQDHTLEKSND 283 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 262 KIIFNGMTVLFKLECPNRPFIKSFL 336 +I+F+ + V FKL NR F ++ L Sbjct: 168 EILFDTVHVTFKLTFDNRAFTQASL 192 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 269 IILYISWHR 243 I LYISWH+ Sbjct: 249 IFLYISWHQ 257 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,994 Number of Sequences: 438 Number of extensions: 4508 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -