BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20803 (562 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 24 0.78 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 24 0.78 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 0.78 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 23 1.4 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 24.2 bits (50), Expect = 0.78 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 272 NAAVQYLFPILDMSENGQCQQLQEWEATRLQ 364 N L+ + + E+G L +WE T L+ Sbjct: 49 NLCTHILYAFVGLREDGSVSVLDDWEMTGLE 79 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 24.2 bits (50), Expect = 0.78 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 272 NAAVQYLFPILDMSENGQCQQLQEWEATRLQ 364 N L+ + + E+G L +WE T L+ Sbjct: 49 NLCTHILYAFVGLREDGSVSVLDDWEMTGLE 79 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 0.78 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 110 HKQKQYWHAKTVNSG*FSSKESRNCGSRV 196 H+Q+ + + + SG SS S C SRV Sbjct: 793 HQQQSHHYGRRERSGSESSSISERCSSRV 821 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 122 VFVCVYLHFNYF*HKNQ 72 VFV YL F+YF +NQ Sbjct: 141 VFVTSYLLFDYFVQRNQ 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,127 Number of Sequences: 336 Number of extensions: 2469 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -