BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20801 (747 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0126 + 18252594-18256922 29 3.0 03_05_0533 - 25332015-25332145,25332231-25332449,25332595-253327... 28 6.9 >05_04_0126 + 18252594-18256922 Length = 1442 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 592 EGENNYIYIFRSIIFQCDVDIVCMYVY 672 EG NN IFR I+ +CD + CM ++ Sbjct: 633 EGGNNNSQIFRDILVKCDPNEFCMRMF 659 >03_05_0533 - 25332015-25332145,25332231-25332449,25332595-25332754, 25332973-25333025,25334998-25335433 Length = 332 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +2 Query: 206 EDLCTGNALTL--IYLFYYLFKKVLPYHKHFTLKITNYLIYGLMHVTIMAYITFAIY 370 +DL G L + +FY V+P H H + + + L+ G +HV +++ ++Y Sbjct: 151 DDLKLGTVLDTSEVAVFYLPAGTVMPLHDHPGMTVFSKLLAGSVHVQSFDWVSPSVY 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,336,536 Number of Sequences: 37544 Number of extensions: 355371 Number of successful extensions: 708 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -